(data stored in ACNUC7421 zone)

EMBL: CP001349.PE213

CP001349.PE213       Location/Qualifiers
FT   CDS_pept        248088..248510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0221"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   met:M446_3163 peptidylprolyl isomerase FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55265"
FT                   /db_xref="GOA:B8I9L2"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L2"
FT                   /inference="protein motif:PFAM:PF00254"
FT                   /protein_id="ACL55265.1"
FT                   /translation="MRLSPFLRAGALLIAMTAAASSADFTTTPSGLKYKDDVVGTGPAP
FT                   AAGQTVSVHYTGWLDEKGRKGKKFDSSVDRGQPLNFAVGTGQVIKGWDEGLSTMKVGGK
FT                   RTLVIPPDLGYGARGAGGVIPPNATLIFDVELLGVR"
     atgcgcctct cccccttcct tcgtgccgga gccctgctga ttgccatgac cgccgctgct        60
     tcctccgccg acttcaccac caccccctcg ggcctcaagt acaaggacga tgtcgtcggc       120
     accggcccgg cgccggcggc cggccagacc gtcagcgtcc attacaccgg ctggctcgat       180
     gagaagggcc gcaagggcaa gaagttcgac agctcggtcg atcgcggcca gccgctcaac       240
     ttcgcggtcg gcaccggcca ggtgatcaag ggctgggacg agggtctctc gaccatgaag       300
     gtcggcggca agcgcacgct ggtgatcccg ccggatctcg gctacggcgc gcggggcgcc       360
     ggcggggtca tcccgccgaa cgccacgctg atcttcgacg tggaactgct cggcgtgcgc       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page