(data stored in ACNUC7421 zone)

EMBL: CP001349.PE214

CP001349.PE214       Location/Qualifiers
FT   CDS_pept        complement(248673..249404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0222"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_3165 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55266"
FT                   /db_xref="GOA:B8I9L3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55266.1"
FT                   /translation="MSAAPALPQAAPALLEVEDLHAYYGKSHILQGVSFHVGAGEIVAI
FT                   LGRNGVGRSTTLKAIMGDVAPRGTVRFKGRPIAGLKPHLVARRGLGYVPEERAIFPGLT
FT                   VRQNLALGEKAGAGARWTTADIFRLFPRLEERIDTPGGVLSGGEQQMLTICRTLMGNPD
FT                   LIMIDEPTEGLSPQMVARVGDLIAEIAARGVAVLLVEQKLTIALKLSQRLYVMGHGRMV
FT                   FEGTPAGLLENEAVRREWLEV"
     atgagcgccg cccccgcgct gccgcaggcc gccccggccc tcctggaggt cgaggacctg        60
     cacgcctatt acggcaagag ccacatcctg cagggcgtaa gctttcacgt cggggcgggc       120
     gagatcgtcg cgatcctcgg ccgcaacggc gtcggccgct cgacgacgct caaggcgatc       180
     atgggcgacg tggcgccccg cggcacggtc cggttcaagg gccggccgat cgccgggctc       240
     aagcctcacc tcgtcgcccg ccgcggcctc ggctacgtgc ccgaggagcg cgcgatcttc       300
     cccgggctca ccgtgcgcca gaacctcgcc ctcggcgaga aggccggcgc gggcgcgcgc       360
     tggaccaccg ccgacatctt ccggctgttc ccgcggctcg aggagcgcat cgacacgccg       420
     ggcggggtgc tgtccggcgg cgagcagcag atgctcacca tctgccgcac gctgatgggc       480
     aacccggatc tcatcatgat cgacgagccg accgaggggc tctcgcccca gatggtggcc       540
     cgggtcggcg atctcatcgc cgagatcgcg gcccgcggcg tcgccgtgct cctggtcgag       600
     cagaagctga cgatcgccct caagctatcg cagcgcctct acgtgatggg ccacggccgc       660
     atggtcttcg agggcacccc cgccggcctg ctggagaacg aggcggtccg gcgggaatgg       720
     ctcgaagtgt ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page