(data stored in ACNUC7421 zone)

EMBL: CP001349.PE215

CP001349.PE215       Location/Qualifiers
FT   CDS_pept        complement(249401..250153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0223"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_3166 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55267"
FT                   /db_xref="GOA:B8I9L4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55267.1"
FT                   /translation="MTPPAVELSGVTKSFGATQIIAGVDLRVPAGERHAIIGPNGAGKS
FT                   TLFNLISGRLVPTSGTIRLEGADITGARPSVINRRGLARSFQVTNIFPRLSVWENVRCA
FT                   VLRAMGYRPLFWRSVERLPGVASRTAEILDSIRLGHRAAMPAGMLAYAEQRALEIGISI
FT                   ASDARVILLDEPMAGMSHSESEHATALIREVTQGRTLLMVEHDMAVVFGLADRISVLVY
FT                   GRLIATDTPERIRENRAVQEAYLGVAAA"
     atgacgcctc ctgccgtcga actctccggc gtgaccaagt ccttcggggc gacgcagatc        60
     atcgcgggcg tggatctccg ggtgccggcc ggcgagcgcc acgccatcat cggcccgaac       120
     ggggccggaa agtcgaccct gttcaacctc atcagcgggc gcctcgtgcc gacatccggg       180
     acgatccgcc tggagggggc cgacatcacc ggggcgcgcc cctccgtgat caaccgccgg       240
     ggcctcgccc gcagcttcca ggtcaccaac atcttccccc ggctctcggt ctgggagaac       300
     gtgcgctgcg cggtgctgcg ggccatgggc taccggcccc tgttctggcg cagcgtcgag       360
     cgcctgcccg gcgtcgcgtc gcgcacggcc gagatcctcg acagcatccg cctcggccac       420
     cgtgccgcga tgccggccgg catgctggcc tatgcggagc agcgggccct ggagatcggc       480
     atcagcatcg cgagcgacgc ccgcgtcatc ctgctcgacg agcccatggc cgggatgagc       540
     cacagcgaga gcgagcacgc caccgcgctc atccgcgagg tgacgcaggg gcgcacgctg       600
     ctgatggtgg agcacgacat ggccgtggtg ttcgggctcg ccgaccgcat ctcggtgctc       660
     gtctacggcc ggctgatcgc caccgacacg cccgagcgca tccgggagaa ccgcgccgtg       720
     caggaagcct acctgggagt cgcggccgca tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page