(data stored in ACNUC7421 zone)

EMBL: CP001349.PE216

CP001349.PE216       Location/Qualifiers
FT   CDS_pept        complement(250158..251483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0224"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   met:M446_3167 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55268"
FT                   /db_xref="GOA:B8I9L5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L5"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACL55268.1"
FT                   /translation="MTDLAEGASAGSDWASSRPVRAVQPRSGSRLGAVAPWLAASAILV
FT                   AAPHVFTSGASLTMMSLMGIMVVFALSYNMLLGQTGLLSFGHAVYYGLGAFFTVHAMNV
FT                   VAAARLPVPLVAMPLVGAVAGLAFGFLFGTVSTRRAGTVFAMISLGLAELVTSGSHILH
FT                   SFFGGEEGVTTNRTKMLRLFDLSFGPQIQVYYLIAGWCLVCALLMYGITRTPLGRLCNA
FT                   VRENPERVEFIGYEPQLVRLVAFCLSALFAGVAGALAAINFEIVNSSYLGLQQSGVVLL
FT                   AAFIGGIGHFVGPVIGAVLVTILQVSLSDLTEVWQLYFGLLFIAIVMFAPGGIAGLALM
FT                   HGPLIRRGTAHRLVPAYALALAPTLVMLAGLVALIEMSFRALVKAGEGTSMTLFGFGLD
FT                   VATPLPWIVAAAAFLGGLLAVRAAWPRVTAAWHAASLAAREG"
     atgacggatc tcgccgaagg cgcctccgcc ggcagcgact gggctagcag ccgcccggtg        60
     cgcgccgtgc agccgcgcag cggcagccgg ctcggggcgg tggcaccctg gctcgccgct       120
     tccgccatcc tggtcgccgc gccgcacgtc ttcacgagcg gcgcctcgct cacgatgatg       180
     agcctcatgg gcatcatggt cgtgttcgcc ctgtcctaca acatgctgct cgggcagacc       240
     gggctcctgt ccttcgggca tgcggtctat tacgggctcg gagccttctt caccgtccat       300
     gccatgaacg tggtggcggc cgcgcggctg cccgtgccgc tcgtcgcgat gcccctcgtc       360
     ggcgccgtcg cgggcctcgc cttcggcttc ctgttcggca cggtttccac gcggcgcgcc       420
     gggaccgtct tcgccatgat ctcgctcggg cttgccgaac tcgtcacctc cggctcgcac       480
     atcctgcaca gcttcttcgg cggcgaggag ggcgtcacca ccaaccgcac caagatgctg       540
     cgcctgttcg atctcagttt cgggccgcag atccaggtct attacctgat cgcggggtgg       600
     tgcctcgtct gcgcgctctt gatgtacggc atcacccgga cgccgctcgg gcggctgtgc       660
     aacgccgtgc gcgagaaccc cgagcgggtc gagttcatcg gctacgagcc gcagctggtg       720
     cgtctcgtcg ccttctgcct ctcggccctg ttcgcgggcg tcgccggcgc cctggcggcg       780
     atcaatttcg agatcgtcaa ttcctcctat ctcgggctgc agcaatcggg cgtggtgctg       840
     ctcgccgcct tcatcggcgg catcgggcat ttcgtcgggc cggtgatcgg cgcggtgctg       900
     gtcaccatcc tgcaggtctc gctcagcgac ctcaccgagg tctggcagct ctatttcggg       960
     ctcctgttca tcgcgatcgt gatgttcgcg ccgggcggca tcgccggcct cgcgctgatg      1020
     cacgggccac tgatccgccg cggcacggcc caccgcctcg tcccggccta tgccctcgcg      1080
     ctcgcgccga cgctcgtcat gctggcgggc ctcgtcgcgc tcatcgagat gagcttccgg      1140
     gccctggtga aggccgggga ggggacctcc atgaccctgt tcggcttcgg cctcgacgtc      1200
     gcgacgccgc tgccctggat cgtggcggct gcagccttcc tcggcggcct gctcgccgtc      1260
     cgggcggcgt ggccgcgcgt caccgcggcc tggcatgcgg cctccctcgc cgcccgggag      1320
     ggctga                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page