(data stored in ACNUC7421 zone)

EMBL: CP001349.PE217

CP001349.PE217       Location/Qualifiers
FT   CDS_pept        complement(251480..252433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0225"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   met:M446_3168 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55269"
FT                   /db_xref="GOA:B8I9L6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L6"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACL55269.1"
FT                   /translation="MLELVIVSTLNGVLYGMLLFLMASGLTLIFSMMGVLNFAHASFYM
FT                   LGAFFGYQISRFAGFWVGLVVAPVLVGGLGALVERYGLRNVHRHGHVPELLFTFGLAYV
FT                   IEEVVQMIWGKLPLDYRVPALLDFPAFTIFDTNYPAYKLFMLLVSVVIFAGLLLVLTRT
FT                   RVGLIIQAALTHPNMVAMLGHDVAKVFMLVFGIGTGLAAVAGVIAGPALVTQSNMAGLL
FT                   GPILFVVVVVGGLGSLTGAFVASLLIGLIQTFAISLDVSIASLFEAFGIAAAPSGGVLG
FT                   DLWTVTIAQIGPVIPYLLLVIVLIFRPTGLLGSREA"
     ttgctcgaac tcgtgatcgt ctcgacgttg aatggcgtgc tctacggcat gctgctcttt        60
     ctcatggcga gcgggctgac gctcatcttc agcatgatgg gcgtgctcaa cttcgcgcat       120
     gccagcttct acatgctcgg cgccttcttc ggctatcaga tcagccgctt cgccggcttc       180
     tgggtcgggc tcgtcgtcgc gccggtcctg gtcggcggtc tcggcgcgct cgtcgagcgc       240
     tacgggttgc gcaacgtcca ccgccacggc cacgtcccgg aactcctctt caccttcggc       300
     ctcgcctacg tgatcgagga agtggtgcag atgatctggg gcaagctgcc gctcgactat       360
     cgggtgccgg cgctcctcga cttcccggcc ttcacgatct tcgacaccaa ctacccggcc       420
     tataagctgt tcatgctgct cgtctcggtg gtgatctttg ccggcctgct gctcgtgctg       480
     acccgcacgc gggtcgggct gatcattcag gcggcgctga cccatcccaa catggtggcg       540
     atgctcggcc acgacgtcgc gaaggtgttc atgctcgtct tcggcatcgg caccgggctc       600
     gccgcggtgg cgggcgtcat cgccgggccc gccctggtga cgcagtccaa catggcgggc       660
     ctgctggggc cgatcctgtt cgtggtcgtg gtcgtgggcg ggctcggctc gctgacgggc       720
     gctttcgtcg cctcgctgct gatcggcctg atccagacct tcgcgatctc gctcgacgtc       780
     tcgatcgcca gcctgttcga ggctttcggc atcgccgccg cgccctccgg cggggtgctc       840
     ggcgacctct ggaccgtcac gatcgcgcag atcgggccgg tcattcccta tctcctgctc       900
     gtgatcgtgc tgatctttcg gccgaccggg ctgctcggga gccgcgaagc atga             954
//

If you have problems or comments...

PBIL Back to PBIL home page