(data stored in ACNUC7421 zone)

EMBL: CP001349.PE218

CP001349.PE218       Location/Qualifiers
FT   CDS_pept        complement(252543..253781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0226"
FT                   /product="ABC transporter, periplasmic branched chain amino
FT                   acid binding protein"
FT                   /note="KEGG: met:M446_3169 ABC transporter, periplasmic
FT                   branched chain amino acid binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55270"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L7"
FT                   /inference="similar to AA sequence:KEGG:M446_3169"
FT                   /protein_id="ACL55270.1"
FT                   /translation="MLRTIARTTAAGLLALAAGTALAAPATLRIAFIDPLSGGGASTGE
FT                   SGLKTFQYMAEQNNAKNPDLKLEVTGYDNKLNSQESLVQLQKAIDSGARIVVQGNGSSV
FT                   AAAIIDFVSKYNDRNPGKEVIYLNYAAVDPALTNAKCSYWHFRFDANSDIKMAALTSFI
FT                   KGKPEIKKVYLINQDYSFGQAVRAAARAMLKEKRPDIQIVGDEVAPLQKVNDFSPYIAK
FT                   IKASGADTVITGNWAQDMALLLKAAGDAGLQANFYTYYGGGTGGPTAIKQANLGDRVFQ
FT                   VAEGFANIPYPPGQDFERAFRARTGQELTYPRVVNLMNVLVKAADAAKSTDPKAIAKAM
FT                   ESIHNDTLYGQDSFMRPDDHQLFQTLYISQLGPVDTSKQFDSENTGWGWKAAGEVSAKD
FT                   TLLPTTCKMDRPS"
     gtgttgagaa cgatcgcgcg caccaccgcg gccgggcttc tggcgctggc ggcgggcacg        60
     gcgctggccg cacccgcgac cctcaggatc gccttcatcg atccattgtc cggcggcggc       120
     gccagcaccg gcgagtccgg cctcaagacc ttccagtaca tggcggagca gaacaacgcc       180
     aagaaccccg acctcaagct ggaggtcacc ggctacgaca acaagctcaa ctcgcaggag       240
     agcctcgtcc agctccagaa ggcgatcgat tcgggcgccc gtatcgtcgt gcagggcaac       300
     ggttcgagcg tcgcggccgc gatcatcgat ttcgtgagca agtacaacga ccgcaatccg       360
     ggcaaggagg tcatctatct caactacgcg gcggtcgatc cggcgctgac gaacgccaag       420
     tgcagctact ggcacttccg cttcgacgcc aattccgata tcaagatggc cgcgctgacc       480
     agcttcatca aaggtaagcc cgagatcaag aaggtctatc tcatcaacca ggactactcg       540
     ttcgggcagg cggtccgcgc agcggcgcgt gcgatgctga aggagaagcg cccggacatc       600
     cagatcgtcg gcgacgaggt cgcaccgctg cagaaggtca acgacttctc gccctatatc       660
     gccaagatca aggcatccgg cgccgacacg gtcatcaccg ggaactgggc gcaggacatg       720
     gcgctgctgc tcaaggcggc gggcgatgcc gggttgcagg cgaatttcta tacctattac       780
     ggcggcggca ccggcggccc gaccgcgatc aagcaggcca acctcggcga ccgcgtcttc       840
     caggtggccg aaggcttcgc gaacattccc tatccgcccg gtcaggactt cgagagggcg       900
     ttccgcgcca ggacgggcca ggaactcacc tatccgcgcg tcgtgaacct gatgaacgtg       960
     ctggtgaagg cggccgatgc agcgaagtcg acggatccga aggccatcgc caaggccatg      1020
     gaatcgatcc acaacgacac gctctacggc caggacagct tcatgcggcc ggacgaccat      1080
     cagctgttcc agaccctgta catctcgcaa ctgggtccgg tggatacgtc gaagcagttc      1140
     gacagcgaga ataccggctg gggctggaag gccgcgggcg aagtcagcgc caaggacacg      1200
     cttctgccga ccacctgcaa gatggaccgg ccgagctga                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page