(data stored in ACNUC7421 zone)

EMBL: CP001349.PE219

CP001349.PE219       Location/Qualifiers
FT   CDS_pept        254049..254924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0227"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: met:M446_3170 IclR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55271"
FT                   /db_xref="GOA:B8I9L8"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L8"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACL55271.1"
FT                   /translation="MSEAFATTRDPQRSRAAAWRDPALLDGEDGDRQFVTALARGLQVL
FT                   RAFKDATEMLGNREIAERTGLPKPTVSRLTHTLLTLGYLVHGEDGERYGLGPAVLALSA
FT                   AFLRQNSFPQMAKPYLQDLATAVQAHVALGLRDGLHSVYIQLWRGLGQTITLSREVGFH
FT                   LPLARSAMGMATLAGMDEEQRAPLVERLRAESGADWPRLEATMARCAAEVADHGFCVGI
FT                   GIWHPEINAVAAPVHSPGTRGLFAINVSGPAFLMTEAVLRRETGPKLLETIDRMRVLGI
FT                   VDEIPRRGGG"
     atgtcagagg ctttcgcgac gacccgcgac ccgcagcgca gccgcgcggc ggcctggcgc        60
     gatcccgcgc tcctcgacgg cgaggatggc gaccgccagt tcgtcaccgc gctcgcccgc       120
     gggctccagg tgctgcgcgc cttcaaggac gcaaccgaga tgctcggcaa ccgggagatc       180
     gccgagcgta ccgggctgcc caagccgacc gtgtcgcgcc tcacgcacac gctgctcacc       240
     ctgggctacc tggtgcacgg ggaggacggc gagcgctacg gtcttggccc cgcggtgctg       300
     gcgctgtcgg cggccttcct tcgccagaac tcgtttccgc agatggccaa gccctacctg       360
     caggatctcg ccaccgcggt tcaggcgcat gtggcgctcg gcctccgcga tgggctccac       420
     agcgtctaca tccagctctg gcggggcctc ggccagacca tcaccctgtc gcgggaggtc       480
     ggctttcacc tgccgcttgc ccgcagtgcc atgggcatgg caacgctcgc cggcatggac       540
     gaggagcagc gcgcgcccct ggtcgagcgg ctgcgcgcgg agagcggtgc ggattggcct       600
     cgcctggagg cgacgatggc gcgctgcgcc gccgaggtgg cggatcacgg cttctgcgtc       660
     ggcatcggga tctggcatcc ggagatcaac gcggtggcgg ccccggtgca cagtcccggc       720
     acccggggcc tgttcgccat caacgtgagc ggcccggcct tcctgatgac cgaggcggtg       780
     ctgcggcgcg agaccgggcc gaagctcctg gagacgatcg accggatgcg cgtgctcggg       840
     atcgtcgacg agatcccgcg ccgagggggc ggatga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page