(data stored in ACNUC7421 zone)

EMBL: CP001349.PE22

CP001349.PE22        Location/Qualifiers
FT   CDS_pept        complement(24264..24503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_0020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55074"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT12"
FT                   /inference="similar to AA sequence:KEGG:M446_0020"
FT                   /protein_id="ACL55074.1"
FT                   /translation="MRSGFGCEACGSPAVRFPAVLHEDAPIQCDRCGCTLMAWGAFKRR
FT                   VEAETVRPDRARGDEAEAPAVSPNGPGSPRSGCA"
     atgcgaagtg ggttcggctg cgaagcctgc ggcagcccgg cggtgcggtt cccggccgtg        60
     ctgcacgagg acgcaccgat ccagtgcgac cgttgcggct gcacgctgat ggcctggggc       120
     gcgttcaagc gccgggtgga agcggagacg gtgcggcccg acagagcccg gggcgatgag       180
     gcggaggcgc ccgccgtcag tccgaatggc cccggatcgc cgcgatcagg gtgcgcttga       240
//

If you have problems or comments...

PBIL Back to PBIL home page