(data stored in ACNUC7421 zone)

EMBL: CP001349.PE220

CP001349.PE220       Location/Qualifiers
FT   CDS_pept        255057..255815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0228"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: met:M446_3175 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55272"
FT                   /db_xref="GOA:B8I9L9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACL55272.1"
FT                   /translation="MISADLRGRCVLVTGGASGIGLAAVTLFARNGAMVALNHLPDDPR
FT                   GPEAATRLADEGLAVMAVPGNVAVAGEAEDLVERSIAALGGLDVLINNAGTPGTHQPIA
FT                   FSDLDAMTEEFWQTILSTNLIGPYRCARAAAPALKTRRGAIVNTASVAGLGRRGSSIAY
FT                   SASKAGLVNLTRSLARALAPEIRVNAVAPGLVETPWTREWPPERKQATLARTLLARLAQ
FT                   PEDIAEAMLFLAAGAAYMTGETLVVDGGSD"
     atgatcagtg cagacctgag gggacggtgc gtcctcgtga ccggcggggc atcgggcatc        60
     gggctcgcgg ccgtcaccct cttcgcccgc aacggcgcca tggtggccct caatcatctg       120
     ccggatgatc cgcgcggccc cgaggccgcg acgcgcctcg cggacgaggg ccttgcggtg       180
     atggcggtgc ccggcaacgt cgcggtggcg ggcgaggccg aggacctggt cgaacggtcg       240
     atcgcggcgc tcggcggcct cgacgtgctc atcaacaatg ccggcacgcc cgggacccat       300
     cagccgatcg ccttctcgga cctcgacgcc atgaccgagg agttctggca gacgatcctg       360
     tcgacgaacc tgatcgggcc ctatcgctgc gcccgggccg cagccccggc gctgaagacg       420
     cggcgcggcg ccatcgtcaa caccgcctcg gtggccgggc tcggacggcg cggatccagc       480
     atcgcctatt cggcgagcaa ggccgggctc gtgaacctca cgcgcagtct cgcccgggcg       540
     cttgctcccg aaatccgggt caatgcggtg gcgcccggcc tcgtcgagac gccctggacg       600
     cgcgaatggc cgcccgagcg caagcaggcg acgctggcgc gcactctgct cgcccgcctg       660
     gcgcagcccg aggacattgc cgaggcgatg ctcttcctcg cggcgggggc ggcctacatg       720
     accggggaga ccctggtcgt cgatggcggc agcgattga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page