(data stored in ACNUC7421 zone)

EMBL: CP001349.PE221

CP001349.PE221       Location/Qualifiers
FT   CDS_pept        255827..256708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0229"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   met:M446_3176 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55273"
FT                   /db_xref="GOA:B8I9M0"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M0"
FT                   /inference="protein motif:PFAM:PF05853"
FT                   /protein_id="ACL55273.1"
FT                   /translation="MSRQTVITCALTGSFNTPSKNPAVPVSPKAIAQSALEAAGAGAAV
FT                   VHIHVRDPETAEPSMDLALYREVVERIRERNADVILNLTTGAGGRFVPGEDDPARPGPG
FT                   TSLASPEARTRHVTALRPEICTLDVATMNFGEHAFLNTPGHLRAMAARIAEAGTRPEIE
FT                   VFDLGQIELAKHLIAEGHLARPPLFQICLGIPWGAPATPETLLQMRDRLPPDAIWSAFG
FT                   ISRAEFPMVALAATAGGHVRVGLEDNLYLSRGQLAPSNAALVEKAATLLSLLDCVPATP
FT                   AEARALFGLAPR"
     atgtcgcgcc agaccgtcat cacctgcgcc ctcaccggct ccttcaacac cccgtcgaag        60
     aacccggccg tcccggtgag ccccaaggcg atcgcccaat ccgcgctcga ggcggccggc       120
     gccggggcgg ccgtggtcca tatccacgtg cgcgatcccg agacggccga gcccagcatg       180
     gacctcgcgc tctaccggga agtggtcgag cgcatccgcg agcggaatgc cgacgtgatc       240
     ctcaacctga ccaccggcgc gggcggccgg ttcgtcccgg gcgaggacga tccggctcgg       300
     cccggccccg gaaccagcct cgcctcgccg gaggcgcgca cccggcacgt cacggcgctc       360
     aggcccgaga tctgcaccct cgacgtggcg acgatgaatt tcggcgagca cgccttcctc       420
     aacacgcccg gccatctgcg ggccatggcg gcccgcatcg ccgaggccgg cacgcggccc       480
     gagatcgagg tgttcgacct cggccagatc gaactcgcca agcatctgat cgcggagggg       540
     catctcgccc gcccgcccct gttccagatc tgcctcggca tcccctgggg agcccccgca       600
     acgcccgaga cgctgctgca gatgcgcgac cggctgccgc cggacgcgat ctggtccgcc       660
     ttcggcatct cgcgcgccga gttcccgatg gtggcgctcg ccgcgacggc cggcggccac       720
     gtgcgggtcg gcctggagga caacctctat ctctcccgcg gccagctcgc gccgagcaat       780
     gcggccctcg tcgagaaggc ggcgacgctg ctctcgctcc tcgactgcgt tccggcgaca       840
     cccgccgagg cgcgcgccct gttcggcctc gcaccgcggt ag                          882
//

If you have problems or comments...

PBIL Back to PBIL home page