(data stored in ACNUC7421 zone)

EMBL: CP001349.PE222

CP001349.PE222       Location/Qualifiers
FT   CDS_pept        complement(256727..257140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0230"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   met:M446_3177 XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55274"
FT                   /db_xref="GOA:B8I9M1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M1"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACL55274.1"
FT                   /translation="MKKAPDPIDRHVGHRVRVRRLLVGVSQEKLGDALGVTFQQIQKYE
FT                   KGANRISASRLQQIAEMLGVPVGFFYEGAPRPENWLDEEHVEVARQPGSDLFWTSQDLQ
FT                   LVRAFQRVDDPQVRRRLVALVEALSGKDVAAQG"
     ttgaagaagg caccggatcc gatcgatcgc cacgtcgggc accgggtgcg ggtccggcgg        60
     cttctcgtcg gcgtgagcca ggagaagctg ggggatgcgc tcggtgtcac gttccagcag       120
     atccagaaat acgagaaggg ggccaaccgc atcagcgcaa gccggctcca gcagatcgcc       180
     gagatgctcg gcgtgccggt cggcttcttc tacgagggcg cgccgcgccc cgagaactgg       240
     ctggatgagg agcacgtcga ggtggcgagg cagccgggct cggacctgtt ctggacgagc       300
     caggatctcc agctcgtgcg ggccttccag cgggtggacg acccgcaggt ccgccgccgc       360
     ctcgtcgccc tcgtcgaggc gctgagcggc aaggacgtcg cggcccaggg ctga             414
//

If you have problems or comments...

PBIL Back to PBIL home page