(data stored in ACNUC7421 zone)

EMBL: CP001349.PE223

CP001349.PE223       Location/Qualifiers
FT   CDS_pept        complement(257161..258831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0231"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="TIGRFAM: apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: met:M446_3178 apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55275"
FT                   /db_xref="GOA:B8I9M2"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M2"
FT                   /inference="protein motif:TFAM:TIGR00546"
FT                   /protein_id="ACL55275.1"
FT                   /translation="MRPPDFDAPSFSAPSRLGAVADRIALASGWQRLALAWLAGACGAL
FT                   AMPPFGILPALAVALVPAVWLLDGAATGTGRLRRRLATAGSAAAIGWAWGFGYFVAGLW
FT                   WLGAAFLVEADQFAVLMPLGVLGLPAVLGLFFGLGFALARLLWSPGWARILALAAGLSA
FT                   AEWLRGHLFTGFPWNTLGMALGQNLWLMQAASVFGLYGLTLLAVLIGAAPATLATGATP
FT                   RARWTPPLLALAVLALLAGAGAWRIPAGPMPDVPGVRLRLVQANIPQDARFNPRNRDGI
FT                   LERYLGLSDSATAPESRGLADVTHLIWPESSFPFLIQRDPKALAQITAALPPGKHLVTG
FT                   AARADEPLPGERLHFYNGILVIGAEGFVGLPYDKHHLVPFGEYLPGPVDRILRAVGLRQ
FT                   FVAVPGGFTAAEGARRPFSVPGLPPVAASICYEVIFPGEVVPQVGARPGLILNLTNDGW
FT                   FGDTPGPRQHFAQARLRAVEEGLPLVRAANTGISAVADPYGRVTGFLPVGAEGVLDRKL
FT                   PRNLGESTFYSRFRDLFFAALLLGSVLLAIGARGRIARP"
     atgcggcctc ccgacttcga cgcgccgagc ttttcggccc cctcgcggct cggcgccgtg        60
     gcggatcgca tcgcgctcgc ctccggctgg cagcgcctcg ctttggcatg gctcgcgggc       120
     gcctgcgggg cgctggcgat gccgcccttc ggcatcctgc cggcgctggc ggtcgcgctc       180
     gtccccgccg tgtggctcct cgacggggcg gcgaccggga ccggtcgcct gcgccgccgc       240
     ctcgccaccg ccgggagcgc cgcggcgatc ggctgggcct ggggcttcgg ctatttcgtc       300
     gccggcctgt ggtggctggg cgcggccttt ctggtggagg ccgaccagtt cgccgtgctg       360
     atgccgctcg gcgtgctcgg cctgccggcg gtgctgggcc tgttcttcgg cttgggcttc       420
     gcgctcgcgc ggctgctctg gtcgcccggc tgggcccgga tcctcgccct cgccgccgga       480
     ctctcggccg ccgagtggct gcgtgggcat ctcttcaccg gcttcccgtg gaacacgctc       540
     ggcatggcgc tcggccagaa cctgtggctg atgcaggcgg cctcggtctt cgggctctac       600
     gggctcacgc tgctcgccgt gctgatcggc gccgcgcccg cgaccctcgc cacgggggcc       660
     acgccgcggg cgcgctggac gccgccgctc ctcgcgctgg ccgtcctcgc gctcctcgcc       720
     ggggcgggag cgtggcggat ccccgccggg ccgatgcccg acgtgccggg ggtgcggctg       780
     cgcctcgtcc aggcgaacat cccccaggat gcccgcttca acccgcgcaa ccgtgacggc       840
     attcttgagc gctatctcgg cctcagcgac agcgcgacgg cgcccgaatc cagggggctt       900
     gccgatgtca cgcacctgat ctggcctgaa tcgtccttcc cgttcctgat ccagcgcgac       960
     ccgaaggccc tcgcccagat caccgccgcg ctcccgccgg gcaagcatct cgtgaccggg      1020
     gccgcccggg ccgacgagcc gctgccgggc gagcggctgc acttctacaa cggcatcctg      1080
     gtgatcggcg ccgagggctt cgtcgggctg ccctatgaca agcaccacct cgtgcccttc      1140
     ggcgagtacc tgcccggacc ggtcgaccgg atcctgcgcg ccgtcggcct gcgccagttc      1200
     gtggccgtcc cgggcgggtt cacggccgcg gagggcgcgc gacgcccctt ctcggtgccc      1260
     gggctgccgc cggtggcggc ctcgatctgc tacgaggtga tcttcccggg cgaagtcgtg      1320
     ccgcaggtgg gcgcccgacc cgggctgatc ctgaacctca ccaatgacgg ctggttcggc      1380
     gatacgccgg gaccccgcca gcattttgcc caggcgcgcc tgcgtgccgt agaggaaggc      1440
     cttcctctcg tccgcgccgc caacaccggc atctccgcag tggccgaccc ttacggacgg      1500
     gtgaccgggt tcctgccggt cggggccgag ggtgtgctcg accggaagct tcccagaaac      1560
     ctaggggaaa gcacgttcta ttcacgtttt cgcgatttgt tttttgccgc tctgcttcta      1620
     gggtctgtcc tgctggccat cggcgcgcgc gggaggatcg cgcggcctta g               1671
//

If you have problems or comments...

PBIL Back to PBIL home page