(data stored in ACNUC7421 zone)

EMBL: CP001349.PE224

CP001349.PE224       Location/Qualifiers
FT   CDS_pept        complement(259265..260386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0232"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein;
FT                   transporter-associated region; KEGG: met:M446_3179 CBS
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55276"
FT                   /db_xref="GOA:B8I9M3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M3"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ACL55276.1"
FT                   /translation="MSNDRSRGAAATAQAAPDEDSPAREPWYDRLLTIFHLKPRETPRD
FT                   EITDALAEAQSGDHAFSPVERAMLKNVLSLHRVRVDDVMVPRADIVAVPDDISLGELLK
FT                   VFRTAGHSRLPVYGETLDDPRGMVHIRDFVDHLAARAEGGSGRGVKPAAEPPPVIQDDG
FT                   RARRPQLARTPSLCEVDLNATLASTRILRPVLFVPPSMPAIDLLVRMQASRTHMALVID
FT                   EYGGTDGLISIEDLVEVVVGDIEDEHDVAEGHRVLRVEGESEIYVADARASLDDVAEAT
FT                   GFDIAAAVGEMAEEVDTIGGLVVTITGRVPSRGEVIAVPGDFEVEVLDADPRRIKRLRL
FT                   HHGPAKLATSAEPLALPPPHTLNGTGAPADAGA"
     atgagcaacg atcgaagtcg tggcgccgcc gcgaccgccc aggccgcccc ggacgaggac        60
     agtccggcgc gcgagccgtg gtatgaccgt ctcctcacca ttttccatct gaagccgcgc       120
     gagaccccgc gcgacgagat cacggacgca ctggccgagg cgcagtcggg cgaccacgcc       180
     ttctcgcccg tcgagcgggc gatgctgaag aacgtgctca gcctgcaccg cgtccgcgtc       240
     gacgacgtga tggtgccgcg ggccgacatc gtggcggtgc ccgacgacat ctcgctcggc       300
     gagttgctga aggtgttccg cacggccggc cattcgcgcc tgccggtcta cggcgagacc       360
     ctcgacgatc cccgcggcat ggtccacatc cgcgatttcg tcgatcatct ggcagcccga       420
     gcggagggcg gctccggccg cggggtgaag cccgccgccg agccgccgcc ggtgatccag       480
     gacgatggcc gggcccggcg gccccaactc gcccgcaccc cgagcctctg cgaggtcgac       540
     ctcaacgcca cgctcgcctc gacccgcatc ctgcggccgg tgctgttcgt gccgccctcc       600
     atgcccgcca tcgatctcct cgtccgcatg caggcgagcc ggactcacat ggccctcgtc       660
     atcgacgagt atggcggcac cgacgggctg atctccatcg aggatctcgt cgaggtcgtg       720
     gtgggcgaca tcgaggacga gcatgacgtc gccgagggcc accgggtgct gcgggtcgag       780
     ggcgaatccg agatctacgt ggcggatgcc cgcgccagcc tcgatgacgt ggccgaggcg       840
     acgggcttcg acatcgcggc ggcggtcggc gagatggccg aggaggtcga cacgatcggc       900
     ggcctcgtgg tcaccatcac gggccgggtt ccctcgcgcg gcgaggtgat cgcggtgccg       960
     ggcgacttcg aggtcgaggt gctggacgcc gatccgcgcc ggatcaagcg cctgcgcctg      1020
     caccacggtc cggcgaagct cgccacctcg gccgagcccc ttgcccttcc gccgccccat      1080
     accctgaacg gcaccggcgc cccggccgat gccggtgcgt ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page