(data stored in ACNUC7421 zone)

EMBL: CP001349.PE225

CP001349.PE225       Location/Qualifiers
FT   CDS_pept        complement(260421..260900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0233"
FT                   /product="protein of unknown function UPF0054"
FT                   /note="PFAM: protein of unknown function UPF0054; KEGG:
FT                   met:M446_3180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55277"
FT                   /db_xref="GOA:B8I9M4"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M4"
FT                   /inference="protein motif:PFAM:PF02130"
FT                   /protein_id="ACL55277.1"
FT                   /translation="MTNEIDVVVEDERWDRAVPDLGGFVRGAVEAALAVLPPGGPVEVS
FT                   VVLTDDAAVQELNRTWRGKDKPTNVLSFPAGHPHGGDLRPLGDVVLAYDTMLRESGEQS
FT                   KPLGHHLAHLLVHGTLHLLGQDHETGEAEAEAMEALEVVALRRLGVPDPYGDAAE"
     atgacaaacg agatcgacgt ggtcgtcgaa gacgagcgct gggatcgggc cgtgccggat        60
     ctcggcggat tcgtgcgtgg cgcggtcgag gcggcgctcg ccgtcctgcc gccgggcggc       120
     cccgtcgagg tgagcgtggt gctcaccgac gacgccgccg tgcaggagct caaccgcacc       180
     tggcggggca aggacaagcc caccaacgtg ctctccttcc cggccggcca cccgcatggc       240
     ggcgacctgc ggcccctcgg cgacgtggtt cttgcgtatg acacaatgct gcgcgagagt       300
     ggggagcagt cgaagcccct cggccaccac cttgcgcatc tgctggttca tggcacgctg       360
     caccttctcg gccaggatca cgagaccggc gaggccgagg ccgaggccat ggaagcgctg       420
     gaagtcgtcg cgctccggcg cctcggcgtt ccggatccct acggcgacgc cgcggagtga       480
//

If you have problems or comments...

PBIL Back to PBIL home page