(data stored in ACNUC7421 zone)

EMBL: CP001349.PE226

CP001349.PE226       Location/Qualifiers
FT   CDS_pept        complement(260926..262035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0234"
FT                   /product="PhoH family protein"
FT                   /note="PFAM: PhoH family protein; KEGG: met:M446_3181 PhoH
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55278"
FT                   /db_xref="GOA:B8I9M5"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M5"
FT                   /inference="protein motif:PFAM:PF02562"
FT                   /protein_id="ACL55278.1"
FT                   /translation="MRPGEASGRGGRTREAAARPVAGLSEAAEIAITFDDNRLASLVFG
FT                   QYDQNVAHLERRLDVLATALGNHVVVKGTPDAAERARLVLETLYARVRDGGGMPMTLGD
FT                   VDGVIQEVSLQGNLFPAAEAPANGERAQFEQIATRRRGAVRARNAAQDAYIKALRANEL
FT                   VFAEGPAGTGKTWLAVGHAVSLLEQGHAERLILSRPAVEAGERLGFLPGDMREKVDPYL
FT                   RPIYDALYDFMEARHVDRGLQTGMIEIAPLAFMRGRTLTNAVVLLDEAQNTTSMQMKMF
FT                   LTRLGENSRMIVTGDPSQIDLLPGQKSGLVEAVRILEGVEGIGRVIFKDADVVRHDLVR
FT                   RIVSAYEADARLTGEQPDSRPAPRRGPLP"
     gtgcgaccgg gagaggcttc gggacgcggc ggacggacac gcgaggcggc ggcgcggccg        60
     gtcgcgggcc tgagcgaggc cgctgagatc gccatcacct tcgacgacaa tcgcctcgca       120
     agcctcgtct tcggccagta cgaccagaac gtcgcccatc tggagcggcg gctcgacgtc       180
     ctggcgacgg ccctcggcaa ccacgtggtg gtcaagggca cgccggacgc cgccgagcgg       240
     gcgcggctcg tgctcgagac gctctatgcg cgggtgcgcg acggaggcgg catgccgatg       300
     acgctcggcg acgtcgacgg cgtcatccag gaggtgtccc tgcagggcaa cctgttcccg       360
     gccgccgagg cgcccgcgaa tggcgagcgc gcgcagttcg agcagatcgc tacccgccgc       420
     cgcggcgccg tgcgcgcccg caacgccgcg caggacgcct acatcaaggc gctgcgcgcc       480
     aacgaactcg tcttcgccga ggggccggcc ggtaccggca agacctggct cgccgtgggc       540
     catgcggtct cgctcctgga gcaggggcat gccgagcgcc tgatcctgtc gcgcccggcc       600
     gtcgaggcgg gcgagcggct cggcttcctg ccgggcgaca tgcgcgagaa ggtcgatccc       660
     tatctccgcc cgatctacga cgccctctac gacttcatgg aggcgcgcca cgtcgaccgg       720
     ggtctgcaga ccggcatgat cgagatcgcg ccgctcgcct tcatgcgcgg gcgcacgctc       780
     acgaacgcgg tggtgttgct cgacgaggcg cagaacacca catccatgca gatgaagatg       840
     ttcctgaccc ggctcggcga gaactcgcgc atgatcgtca ccggcgatcc gagccagatc       900
     gacctgctgc cgggccagaa atccggcctc gtcgaggcgg tgcgcatcct cgaaggggtg       960
     gagggcatcg gccgcgtgat cttcaaggat gcggacgtgg tccgtcacga cctcgtgcgc      1020
     cgcatcgtca gcgcctacga ggcggatgcg cgcctgaccg gcgagcagcc ggacagccgt      1080
     ccggcgcccc ggcgcggtcc cctgccgtga                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page