(data stored in ACNUC7421 zone)

EMBL: CP001349.PE227

CP001349.PE227       Location/Qualifiers
FT   CDS_pept        complement(262047..263390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0235"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: met:M446_3182 RNA modification protein;
FT                   TIGRFAM: RNA modification enzyme, MiaB family; tRNA-i(6)A37
FT                   thiotransferase enzyme MiaB; PFAM: deoxyribonuclease/rho
FT                   motif-related TRAM; Radical SAM domain protein; Protein of
FT                   unknown function UPF0004; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55279"
FT                   /db_xref="GOA:B8I9M6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M6"
FT                   /inference="protein motif:TFAM:TIGR00089"
FT                   /protein_id="ACL55279.1"
FT                   /translation="MKKAFVKSYGCQMNVYDAARMVDLLGREGFTETAVIEEADVVVLN
FT                   TCHIREKAAEKVYSELGRVRDLKGERAEAGRETTIVVAGCVAQAEGREIIHRAPAVDVV
FT                   VGPQSYHRLPDLLRRARAEKVVDTEFPIDDKFDHLPPRRIAGVSSFLTVQEGCDKFCAF
FT                   CVVPYTRGAEVSRPVAKVLAEAERLAAGGARELTLIGQNVNAYHGEGPDGATWSLGRLL
FT                   RRLAEVPGIARLRYTTSHPRDMDDDLIAAHRDCPALMPYLHLPVQSGSDRVLAAMNRKH
FT                   DAETYLRLIDRIRTARPDIALSSDFIVGFPGETDADHAATMRLVAEVGFASAFSFKYSP
FT                   RPGTPAAESADAVPEAVKRERLAELQALLEEQNRAFNRATIGRTVEVLFEKPGRHPGQV
FT                   AGKSPYLQAVQIEADPAVIGTVLPVRLTRPGSNSLFGERAEAAPAAAA"
     ttgaagaaag cgttcgtcaa atcctacggc tgccagatga atgtctacga cgcggcccgg        60
     atggtggatc tgctcggccg cgagggcttc acggaaacgg ccgtgataga ggaggcggac       120
     gtcgtcgtcc tcaacacctg tcacatccgc gagaaggcgg ccgagaaggt ctattccgaa       180
     ctcggccggg tgcgcgacct caagggcgag cgggcggagg ccggccgcga gacgacgatc       240
     gtcgtggcgg gctgcgtggc gcaggccgag ggccgcgaga tcatccaccg ggcgcccgcc       300
     gtggacgtgg tggtcggccc gcagagctac caccgcctgc ccgacctgct gcgccgcgcc       360
     cgggccgaga aggtcgtcga caccgagttt ccgatcgacg acaagttcga ccacctgccg       420
     ccgcgccgca tcgccggcgt ctcctccttc ctcaccgtgc aggagggctg cgacaagttc       480
     tgcgccttct gcgtcgtgcc ctacacgcgg ggcgccgagg tctcgcggcc ggtcgccaag       540
     gtgctggcgg aggccgagcg gctggcggcc ggcggcgccc gcgaactcac gctcatcggc       600
     cagaacgtca acgcctatca cggcgagggc ccggacgggg cgacctggtc gctcgggcgc       660
     ctgctgcggc ggctcgccga ggtgccgggc atcgcccggc tgcgctatac gacgagccac       720
     ccgcgggaca tggacgacga cctcatcgcc gcccatcggg attgtccggc gctgatgccc       780
     tatctgcacc tgccggttca gtcgggctcc gaccgcgtcc tcgcggccat gaaccgcaag       840
     cacgacgccg agacctacct gcgcctgatc gaccgcatcc gcacggcgcg gcccgacatc       900
     gccctctcgt ccgacttcat cgtcggcttt ccgggcgaga cggatgccga tcatgcggcg       960
     acgatgcggc tcgtcgccga ggtcggcttc gccagcgcct tctcgttcaa gtacagcccg      1020
     cgtcccggga cgcctgcggc cgagagcgcc gacgcggttc cggaggcggt caagcgcgag      1080
     aggctcgcgg agctgcaggc gctcctggag gagcagaacc gcgccttcaa ccgcgccacg      1140
     atcgggcgca cggtcgaggt gctgttcgag aagccgggcc gccatcccgg gcaggtcgcc      1200
     ggcaagtcgc cctatctcca ggcggtgcag atcgaggccg atccggccgt gatcggcacg      1260
     gtgcttccgg tgcgcctcac ccggcctggg tccaacagcc tgttcgggga acgggcggag      1320
     gcggcgccgg ccgccgcagc ttga                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page