(data stored in ACNUC7421 zone)

EMBL: CP001349.PE228

CP001349.PE228       Location/Qualifiers
FT   CDS_pept        complement(263569..263973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3183 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55280"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M7"
FT                   /inference="similar to AA sequence:KEGG:M446_3183"
FT                   /protein_id="ACL55280.1"
FT                   /translation="MRMFRPALLGLLSLAALGAGTAVSEAQDSYVIRSYRGGQGLAIRV
FT                   RPRSWLDAGNVVEPNSGAVSNPATNPHFITASYLSSPPYIANRERWGGAGVLPDPITNG
FT                   PFIGARRAAVTVDLSGIDYLDPTSPLARGY"
     atgcgcatgt tccgaccggc cctgctcggg ctcctctcac tcgcggcgct cggcgccggc        60
     accgccgtct cggaggcgca ggacagctac gtcatccgca gctatcgcgg cgggcagggc       120
     ctcgcgatcc gcgtgcggcc gcgcagctgg ctcgatgccg gcaacgtggt cgagccgaat       180
     tcgggcgcgg tctccaaccc ggcgacgaac ccgcatttca tcacggcgtc ctatctgagc       240
     tcgccgccct atatcgccaa ccgcgagcgc tggggcgggg ccggcgtcct gcccgacccg       300
     atcaccaacg gcccgttcat cggcgcccgc cgcgccgccg tcacggtcga cctctcgggc       360
     atcgactatc tcgacccgac ctcgccgctc gcccgcggct actga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page