(data stored in ACNUC7421 zone)

EMBL: CP001349.PE229

CP001349.PE229       Location/Qualifiers
FT   CDS_pept        complement(264029..265036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0237"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55281"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M8"
FT                   /inference="similar to AA sequence:KEGG:M446_3184"
FT                   /protein_id="ACL55281.1"
FT                   /translation="MIGTSRGQLPAANRMARRLRLHGCAAIRSRPLHAFGGPVPLRDFD
FT                   DAALMRAGRALARDLGPADPVVPRPLPRAVRRRSWHPLRRSIGAAAVIALISILASERR
FT                   DVPPEAAAPLAPPPAWEAAAPDRYRLDGAEEARATARRRPGLGLREDSLALGTFGAVET
FT                   LFLRITLADAPDPETSLFVSLARRAAEHDGLAVIKTGDRGQVDSRFGPVETLEATLSGE
FT                   EGRRVCTAFRVIDATVRLDGWLCAPLGLLPEPVAVGCAIDRLTARPNVLLPAALVDLLT
FT                   RPARPVCAPPEPVAALVPRKSRDRKNAAKVRQSAQAWQDPGTTAALGRHPGTSR"
     atgatcggca cgagccgtgg acaattgccc gccgccaacc ggatggcgag gcggctgcgg        60
     ttgcatgggt gcgcggccat ccgttcccgg ccgcttcacg cattcggagg ccccgtgccg       120
     ctgcgggatt tcgatgacgc ggccctgatg cgggccggac gcgcgctggc ccgcgatctc       180
     gggccggccg atccggtggt gccgcggccg ctgccccggg ctgtccggcg gcgcagctgg       240
     catccgctgc gcaggagcat cggcgccgcc gcggtgatcg cgctcatcag catcctggcg       300
     agcgagcgcc gggacgtgcc gccggaggcg gctgccccgc tcgccccgcc ccccgcctgg       360
     gaggcggccg cgccggaccg ctaccgcctc gacggcgccg aggaagcccg ggcgacggcg       420
     cggcgccggc cgggcctcgg cctgcgggag gacagcctcg cgcttggcac cttcggggcc       480
     gtggagacgc tgttcctgcg gatcaccctc gcggatgcgc ccgacccgga gacgagcctg       540
     ttcgtgagcc tcgcgcgccg ggccgccgag cacgatggcc tggcggtgat caagaccggc       600
     gaccgcggtc aggtcgacag ccgcttcggc ccggtcgaga cccttgaggc gacgctctcg       660
     ggggaagagg gcaggcgggt ctgcacggcc ttccgcgtca tcgacgccac ggtgcggctc       720
     gacggctggc tctgcgcgcc cctcggccta ctgcctgagc ccgtggcggt cggctgtgcc       780
     atcgaccggc tcaccgccag gcccaacgtc ctcctgcccg ccgccttggt cgacctcctc       840
     acgcggcccg cgcgcccggt ctgcgcgccg cccgagccgg tggcggcatt ggtgccgcgc       900
     aagtcgcgcg atcggaagaa tgcggcgaaa gtgcgacaat cggcccaagc gtggcaggat       960
     cccggaacca cggccgcgct cgggcgtcat cctgggacaa gccgctga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page