(data stored in ACNUC7421 zone)

EMBL: CP001349.PE23

CP001349.PE23        Location/Qualifiers
FT   CDS_pept        complement(24591..24980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0024"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   met:M446_0021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55075"
FT                   /db_xref="GOA:B8IT13"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IT13"
FT                   /inference="protein motif:PFAM:PF02021"
FT                   /protein_id="ACL55075.1"
FT                   /translation="MTRTDDPAARRRRATYLRGHGAERLALLALLLKGYRPLARRFAAA
FT                   GGEIDLVMRRGSVIAFVEVKARPTLDAAAAAIDARKRRAFSRAARAWIARHPWSAGLTL
FT                   RADAVFVAPRRWPRHLVSAFDLEPS"
     atgacgagga ctgacgatcc ggcggcgcgc cggcggcgcg ccacctatct gcgcgggcac        60
     ggggccgagc ggctcgccct gctggcgctg ctcctcaagg gctaccggcc gctcgcgcgg       120
     cgcttcgcgg ccgcgggcgg ggagatcgat ctcgtcatgc ggcgcggcag cgtcatcgcc       180
     ttcgtcgagg tgaaggcccg gccgaccctc gacgcggccg ccgcggcgat cgacgcgcgc       240
     aagcgccgcg ccttctcgcg ggcggcccgc gcctggatcg cgcggcatcc ctggagcgcc       300
     gggctcaccc tgcgggccga cgcggtcttc gtcgcaccgc ggcgctggcc gcgtcatctc       360
     gtctccgcct tcgaccttga gccgtcctga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page