(data stored in ACNUC7421 zone)

EMBL: CP001349.PE230

CP001349.PE230       Location/Qualifiers
FT   CDS_pept        265366..266400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0238"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="TIGRFAM: aspartate-semialdehyde dehydrogenase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding; Semialdehyde
FT                   dehydrogenase dimerisation region; KEGG: met:M446_3185
FT                   aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55282"
FT                   /db_xref="GOA:B8I9M9"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M9"
FT                   /inference="protein motif:TFAM:TIGR01296"
FT                   /protein_id="ACL55282.1"
FT                   /translation="MGYKVAVVGATGNVGREMLDILAERAFPADTVVALASRRSLGQEV
FT                   SFGDKTLKVQALDQYDFSDTDICLMSAGGETSKEWSPRIGSQGCVVIDNSSAFRYDSDV
FT                   PLIVPEVNADAVVGFSKKNIIANPNCSTAQLVVALKPLHDAATIKRVVVATYQSVSGAG
FT                   KEAMDELFNQTRAVFTAGEVKVQKFTKRIAFNVIPHIDVFMEDGSTKEEWKMVAETKKM
FT                   LDPKIKLTATCVRVPVFIGHSEAVNVEFERPISAEEAREILRSAPGVLVDDKREPGGYI
FT                   TPHEAAGEDATYVSRIREDITVENGLSFWCVSDNLRKGAALNTVQIAEVLINRKLISPK
FT                   QKAA"
     atgggttaca aggttgccgt cgtcggagcc accggcaatg tgggccggga gatgctcgac        60
     atcctggcgg agcgcgcctt cccggccgac acggtggtgg cgctcgcctc gcgccgcagc       120
     ctcggccagg aggtgtcctt cggcgacaag acgctgaagg tccaggccct cgatcagtac       180
     gatttctccg acacggacat ctgcctgatg tcggccggcg gcgagacctc caaggaatgg       240
     tcgccgcgca tcggcagcca gggctgcgtc gtcatcgata actcgtcggc gttccgctac       300
     gattccgacg tgccgctgat cgtgcccgag gtgaacgcgg acgcggtggt cggcttctcg       360
     aagaagaaca tcatcgccaa cccgaactgc tcgaccgctc agctcgtcgt ggccctcaag       420
     cccctgcacg acgccgccac catcaagcgg gtcgtggtgg cgacctacca gtcggtctcg       480
     ggggccggca aggaggcgat ggacgagctg ttcaaccaga cccgggcggt cttcaccgcc       540
     ggcgaggtca aggtccagaa gttcaccaag cggatcgcct tcaacgtcat cccgcacatc       600
     gacgtcttca tggaggacgg ctccaccaag gaagagtgga agatggtggc cgagacgaag       660
     aagatgctcg atcccaagat caagctgacg gcgacctgcg tgcgcgtgcc ggtgttcatc       720
     ggccattcgg aggcggtgaa cgtggagttc gagcggccga tcagtgccga ggaggcgcgc       780
     gagatcctgc gctcggcgcc gggcgtgctc gtcgacgaca agcgcgagcc gggcggctac       840
     atcaccccgc acgaggcggc gggcgaggac gccacctacg tgtcgcgcat ccgcgaggac       900
     atcacggtcg agaacggcct gtccttctgg tgcgtgtccg acaacctgcg caagggcgca       960
     gcgctcaaca ccgtccagat cgccgaggtg ctgatcaacc gcaagctgat cagcccgaag      1020
     cagaaggcgg cctga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page