(data stored in ACNUC7421 zone)

EMBL: CP001349.PE231

CP001349.PE231       Location/Qualifiers
FT   CDS_pept        266492..268021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0239"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: met:M446_3186
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55283"
FT                   /db_xref="GOA:B8I9N0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N0"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ACL55283.1"
FT                   /translation="MAPTVLSVRDDLLAVLERLGIPAPFTGEGGVPARSPIDGLTIGHL
FT                   HETTDAEAEAAIGRAAEVFLAWRRVPAPRRGELVRLLGEELRAAKADLGRLVMLETGKI
FT                   LSEGLGEVQEMIDICDFAVGLSRQLHGLTIATERPDHRMMEVWHPLGPCGVITAFNFPV
FT                   AVWSWNAALALVCGDPVLWKPSEKTPLTALAVQAIAGRALKRFGAEAPEGLLQVLIGGR
FT                   SLGERLAADPRIPLVSATGSTAMGRQVAPVLAARFARAILELGGNNAAIVAASADLDLA
FT                   LRAVAFAAMGTAGQRCTTLRRLFVQESIYDAFLPRLRTAYASVRIGDPRDPATLVGPLI
FT                   DLSAADGMARALDEARALGATIQGGERLSDIRGDAAAYLRPALVEMRTQAGPMLRETFA
FT                   PILYVVPYRELDEAIAAQNAVAAGLSSSIFTRDLSEAEIFLSVAGSDCGIANVNIGPSG
FT                   AEIGGAFGGEKATGGGREAGSDSWKAYMRRATNTINYGKSLPLAQGVSFEL"
     atggccccga ccgtcctctc cgtccgcgac gacttgctgg ccgtcctgga gcggctcggt        60
     atcccggcgc ccttcacggg cgagggcggc gtcccggccc gctcgcccat cgacggcctc       120
     accatcgggc atctgcacga gaccaccgat gcggaggctg aggccgcgat cggccgcgcc       180
     gccgaggtat ttctggcctg gcgccgcgtc ccggcgcccc gtcgcggcga gctggtgcgg       240
     ctcctcggcg aggagctgcg cgccgccaag gccgatctcg gccggctggt gatgctggag       300
     acgggaaaaa tcctctccga gggcctcggc gaggtgcagg agatgatcga catctgcgat       360
     ttcgcggtcg gtctctcgcg ccagcttcac ggcctcacca tcgcgaccga gcggcccgac       420
     caccggatga tggaggtctg gcatccgctc gggccctgcg gcgtcatcac ggccttcaac       480
     ttccccgtgg cggtgtggtc gtggaacgcg gcgctcgccc tcgtctgcgg cgatccggtg       540
     ctgtggaagc cgtccgagaa gacgccgctg accgcgctcg ccgtgcaggc gatcgccggg       600
     cgggcgctca agcgcttcgg cgccgaggcg ccggagggcc tgctgcaggt gctgatcggc       660
     gggcgctccc tcggcgagcg gctcgccgcc gatccgcgca ttcccctggt ctcggcgacg       720
     ggatcgaccg ccatgggccg gcaggtggcc ccggtgctcg ccgcgcgctt cgcccgggcc       780
     atcctcgaac tcggcggcaa caacgccgcg atcgtcgccg cttccgccga tctcgacctc       840
     gcgctgcgtg ccgtcgcctt cgcggccatg ggcaccgcgg gccagcgctg cacgacgctg       900
     cggcgcctgt tcgtgcagga gagcatctac gacgcctttc tgccgcgcct gcgcacggcc       960
     tatgcgtcgg tgcggatcgg cgatccgcgc gatcccgcca ccctcgtcgg cccgctcatc      1020
     gacctttcgg cggcggacgg aatggcgcga gccctcgacg aggcgagggc gctgggggcg      1080
     acgattcagg gcggggagcg cctgtccgac atccgcggcg atgcggcggc ctatctccgc      1140
     ccggccctcg tcgagatgcg aacccaggcc ggcccgatgc tgcgggagac cttcgcgccc      1200
     atcctctacg tggtacccta ccgggagctg gacgaggcga tcgcggcgca gaatgcggtg      1260
     gcggccggtc tctcctcctc gatcttcacc cgggatctgt ccgaggccga gatttttctg      1320
     tcggtggcgg gctccgattg cggcatcgcc aacgtcaata tcggcccctc cggcgccgag      1380
     atcggcggcg ccttcggggg cgagaaggcg accggcggcg gccgcgaggc cggttcggat      1440
     tcctggaagg cctatatgcg ccgggccacc aacaccatca attacggcaa gagcctgccg      1500
     ctggcgcagg gcgtgagctt cgagctctag                                       1530
//

If you have problems or comments...

PBIL Back to PBIL home page