(data stored in ACNUC7421 zone)

EMBL: CP001349.PE232

CP001349.PE232       Location/Qualifiers
FT   CDS_pept        complement(268333..269355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0240"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: mlo:mlr6069 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55284"
FT                   /db_xref="GOA:B8I9N1"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N1"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACL55284.1"
FT                   /translation="MGEYIGLDVSLKETALSVRRDGKRVWRGRCASDPAVIARVLRKHA
FT                   PEAQRIVFETGPLSVWFYHALRAEGLPAICIDARHAKAALDMAANKTDANDADGLAHLA
FT                   EVGFFREVRVKGYDSLLVRTLVAARSKLVQVTTELSNQIRGLMKTFGLIVPGAKGGSFE
FT                   AEVRRLLSGDHGLARVILPLLEAWNAVRRRAAELGRQLLAGARQSQACQRLMAIPGIGA
FT                   ITATAFVTAIEDPANFRSSRSVAAWFGLTTRRYQSGEVDYDGHISRRGDAHMRGLLYEA
FT                   ATVLLTRSQVDSDLRAWGLKLRERLGFKRAAVAVARKLAVVMHAMLKSGHSYRAKAAMA
FT                   "
     atgggtgagt atatcggtct cgacgtgtcc ctgaaagaga cggcgctcag cgtgcggcgg        60
     gacggcaagc gtgtttggcg cggcaggtgc gcttccgatc ctgccgtcat tgccagggtg       120
     ctgcgcaagc atgcgcccga agcccaacgg atcgtatttg agacgggtcc tttgtcagtt       180
     tggttctacc acgcgctgcg cgccgaaggc ttgccagcga tctgcatcga cgcgcgccat       240
     gccaaggccg cgctcgacat ggccgccaac aaaaccgacg ccaacgatgc cgacgggctg       300
     gcccatctgg ccgaggtcgg cttcttccgc gaagtgcggg tgaagggata cgacagcctg       360
     ctcgtgcgaa cgcttgtcgc cgcgcgcagc aagctcgtgc aggtgacgac cgagctatcc       420
     aatcagatcc gcggcctgat gaagacgttc ggcttgatcg tgccgggcgc aaagggcgga       480
     tcgttcgagg cggaggttcg acgtctcctg tcgggcgatc acggtctggc tcgcgtcatc       540
     cttccgctgc ttgaggcctg gaacgcggtt cgccgtcgag cagcggagct cggacgccag       600
     cttctggccg gtgcacggca gagccaagcc tgccagcggc tgatggcgat tcccgggatc       660
     ggggcgatca ccgcgaccgc cttcgtgacc gcgatcgagg atcccgccaa cttccgatcg       720
     tcccgctccg tcgccgcctg gttcgggttg acgacgcggc gctatcagtc gggcgaggtc       780
     gactatgacg ggcatatctc ccggagagga gacgcccata tgcgagggct tctctacgag       840
     gcggcgaccg ttctcctgac gcgtagccag gtggacagcg acctgcgagc ctggggactg       900
     aagctgcgcg agcggctcgg cttcaagcgc gccgccgtgg cggtcgcgcg caagctggcc       960
     gtcgtcatgc acgccatgct gaagtccggc cactcctacc gtgcgaaggc tgccatggcc      1020
     tga                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page