(data stored in ACNUC7421 zone)

EMBL: CP001349.PE233

CP001349.PE233       Location/Qualifiers
FT   CDS_pept        269915..270835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bid:Bind_2168 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55285"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N2"
FT                   /inference="similar to AA sequence:KEGG:Bind_2168"
FT                   /protein_id="ACL55285.1"
FT                   /translation="MVNVVQQWNPDDWESFALSLLQVRHGILNVQKVPATHRGDFGIDF
FT                   YCTAASVIYQCFAVEEPVDVVARATRQKNKITTDLRKLVDGAVEVSQLFLGVPVKKWIL
FT                   LVPLHDSKDVNLHCAKKTTDTRALQLAHLDTDFEVCVHDQGAFPGAALSAAISALTNLS
FT                   LSVQAPTQKELEEWQAGSPNLLANATKKLSKRTAPGGVQDAVVSGVELFLKGNALVDAL
FT                   RSSAPDLHEKVVAAISGRARRLSYVGPQGGPAPNNIMNTELNTLINAIKDAAPTLSQAN
FT                   AEDIALGTLSDWIMRCPLDFPSNGS"
     gtggtcaatg ttgtgcagca atggaatccc gacgactggg agtcctttgc gctaagcctg        60
     ttgcaggtgc gccatggcat tttgaatgtt cagaaagtgc ccgccaccca tcggggtgat       120
     ttcggcatcg atttctactg caccgcagca tccgtcatct accaatgctt cgcggttgag       180
     gaacccgtcg acgttgttgc tcgtgccact cggcaaaaga acaagatcac cacggacctg       240
     aggaaattgg tggatggcgc agtcgaggta tcacagctgt tcctcggcgt acccgtgaaa       300
     aaatggattc ttcttgttcc cctgcacgat agcaaagacg tcaatcttca ctgtgcaaag       360
     aagacgacgg atacgagggc gctgcagctt gcgcacctcg acaccgattt tgaggtgtgt       420
     gttcacgatc agggtgcctt tccaggagcg gccttgagcg ccgccatttc cgccctgacc       480
     aacctgtccc tgagcgtcca agcgccgacc caaaaggaac tggaagagtg gcaggcggga       540
     tccccgaacc tcctggccaa tgccactaag aagctctcca aacgcacagc cccgggaggc       600
     gtccaggatg ccgtagtcag cggggtggag cttttcttga agggcaacgc gctcgtcgac       660
     gccttgcgct caagcgcgcc cgatctccat gaaaaggtcg ttgctgccat ctctgggcgc       720
     gcccggcgcc taagctatgt cggaccgcaa ggcggcccgg ctccaaacaa catcatgaac       780
     accgagctca atactctaat caacgcgatc aaggacgctg cacccacgct atctcaagcg       840
     aacgcggagg acatcgcgct cggaactttg tcggactgga tcatgcgctg tccgctggat       900
     ttcccgtcca atggcagctg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page