(data stored in ACNUC7421 zone)

EMBL: CP001349.PE234

CP001349.PE234       Location/Qualifiers
FT   CDS_pept        270825..271313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bid:Bind_2169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55286"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N3"
FT                   /inference="similar to AA sequence:KEGG:Bind_2169"
FT                   /protein_id="ACL55286.1"
FT                   /translation="MAADNFFRQAIEGATFSFTARPEPVAGDLRMSWGIGVLLLSLFYA
FT                   RGKKGSFPKLQFLAHAIRTQEGREDVRALMAGRLRTTDISVRVEPWLNRAVSYAHGLGF
FT                   VDVTKGKSVGLTEKGREVAAALDADKSVFKEERAFLAEVTKKLTEAQLTKIWRMEDLL"
     atggcagctg acaatttctt ccgtcaggcg atcgaagggg cgacgttctc cttcaccgcg        60
     aggccagagc cggtcgcggg cgacctcagg atgtcgtggg ggattggtgt tctgctgctc       120
     agccttttct atgcccgcgg caaaaaggga agtttcccaa agctgcagtt cttggcgcat       180
     gcgatacgaa cccaggaagg gcgggaagac gtccgcgcgc tgatggctgg acgtctacgc       240
     accacagata tctcggtgcg ggtcgagccg tggctgaacc gggcagtctc ctacgcccac       300
     ggtcttggat ttgtcgacgt cactaagggc aagtcggttg ggctgaccga gaagggcaga       360
     gaggtggcgg cggcgctcga tgctgacaag agcgtgttca aggaagagcg tgcttttctg       420
     gctgaagtca ccaagaagct cacagaagct caactgacaa agatctggcg aatggaggat       480
     ctattgtga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page