(data stored in ACNUC7421 zone)

EMBL: CP001349.PE235

CP001349.PE235       Location/Qualifiers
FT   CDS_pept        271310..273355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bid:Bind_2170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55287"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N4"
FT                   /inference="similar to AA sequence:KEGG:Bind_2170"
FT                   /protein_id="ACL55287.1"
FT                   /translation="MTLRLRHLRMRAMTSAGLYGTDIGFELGLNVIWADNTKGKSTCMQ
FT                   GMLYALGLEKMLSPRREVPLPHAMTSFLRNDDETTATILESGVSLEIQNGAGTIVTVHR
FT                   PVKKAGVDNRLISVDFGPTLTDPEARPERRDFFVLDAGAAQREDGFHRFLEDFLGWQLP
FT                   IVRRYDSPEGKLYLETIFPLFWVEQKAGWSSIPAAIPTYLRIREVQKRAVEFIMDLNIH
FT                   KLELERQRLQERIDQNARDWRNLWDEIDRYARRSGGKTDALPQRPTIVPNELAKGHVLI
FT                   AEKGSWVSLKDMLAQLRGRVAELNGVPVPAVGTSVDHLERQLEALGKEVEGVNRARIEV
FT                   HKAKQLKEADIGSLERRIRSLADDMQKNQDVQKFQRYSGTARSLTPDYCPTCEQALVDS
FT                   LMSQKVLTAIMPIEDNIEYIRSQMKMFDDILKREQEEMSKIEIRTAQVDRDLNELYSRI
FT                   RTVRTDLIAPTGNPSAVAIEERVRTEARIRELETIQATFDDTVARMQTLASAFGDLLLA
FT                   VADLPKDKMSPLDRSKFDTLTALLRQLAREFGFSTFDASELTIDEDTYRPQKEGYEIGF
FT                   ETSASDAIRLKWAYQLGLLELSHRHPTHHPGMLLLDEPRQQSSSRVSFGSLLERAATHQ
FT                   RVDQQIIISTSEDLEMLKEILSRITCKDTIIPGYVIKPVSVTGSVH"
     gtgacgctgc gccttcggca tttgcgcatg cgcgcgatga cctccgcagg actttacggg        60
     acggacattg gctttgagct aggtctgaac gtaatctggg ccgacaacac caagggaaaa       120
     tccacctgca tgcaggggat gctctatgcc ttggggctgg aaaagatgct cagtccgcgt       180
     cgtgaagtgc cattgcctca tgccatgacc tcctttttga ggaacgacga cgaaacgacc       240
     gcgacgatct tagaatcggg cgtgtcgctg gaaatccaaa atggggccgg caccatcgtt       300
     accgtccatc gccccgttaa gaaggccggt gtcgataatc gactgattag cgtggatttt       360
     ggcccgactc ttacggatcc tgaggcgcgt ccggagcgac gcgatttttt cgttctggac       420
     gcaggggctg cgcaacggga agacggattc caccgcttcc tggaggattt ccttgggtgg       480
     cagctgccaa ttgttcggcg ctacgacagc cctgaaggta agctctatct cgaaacgatc       540
     ttcccgcttt tctgggtgga acagaaggcc ggatggtcct ctatcccagc cgctatccca       600
     acttatttga gaatccggga ggtccagaag cgggccgtcg aattcatcat ggatctcaac       660
     atccataagc tcgaactcga gcgacaacgc ctgcaagagc gcatcgacca aaatgcgaga       720
     gactggcgaa atctctggga cgagatagac cgctacgcgc gtcgcagcgg cggtaagacc       780
     gatgcgctgc ctcaacggcc gaccatcgtg ccgaacgaac tcgcaaaagg gcatgtgctg       840
     attgcggaaa agggatcgtg ggtttcgctg aaggatatgt tggcgcaact gcgggggcgc       900
     gtcgccgaac ttaacggggt gccggtgccg gccgtcggga cttcggtcga ccatctagag       960
     cgccaactgg aggccctcgg aaaggaggtc gagggcgtca accgtgctcg cattgaggtc      1020
     cacaaagcca agcagttgaa ggaggcggac atcggctcat tggagcgccg gatccgatcc      1080
     ttggctgacg acatgcaaaa aaatcaagac gtccagaagt tccagcgtta ttctggcact      1140
     gccagatcgc tgacgcccga ttactgtcca acctgtgagc aagcgctagt cgattcccta      1200
     atgtcccaaa aagtcctgac ggcgattatg ccgatcgagg acaatattga gtacattcgc      1260
     tcgcagatga aaatgttcga cgacattttg aagcgtgagc aggaggagat gtccaagatc      1320
     gagattcgga ctgcgcaagt cgatcgcgat ctcaacgaac tttacagccg cattagaacc      1380
     gttcgcaccg atcttatcgc cccgacgggc aatccatccg ctgtcgctat tgaagagcgg      1440
     gtgaggaccg aggcacgaat ccgcgagttg gagacaatcc aggcgacttt cgatgatacg      1500
     gtcgcgcgga tgcagacatt ggcaagcgcc tttggcgacc tgctcctggc cgtggcggat      1560
     ttgcccaagg acaaaatgag ccccctggat cgaagcaagt tcgacacgct tactgcgctc      1620
     ctgcgacagc tagcccggga atttggcttc tcgacattcg atgcaagcga actgacaatc      1680
     gacgaggaca cctatcggcc acaaaaagaa ggctacgaga tcgggttcga gacgtcagcg      1740
     agtgacgcaa ttcggctaaa gtgggcttat cagcttggac tcttggagtt gagtcaccgg      1800
     catccaactc atcatccggg catgttgctg ctcgacgaac cccgccagca gtcgtcgtcg      1860
     cgagtcagct ttggaagcct gctcgagcgg gctgcaactc atcagcgcgt cgatcagcag      1920
     atcatcatct ccaccagtga ggatcttgag atgctcaagg aaattctctc gcgtattacg      1980
     tgcaaggaca cgatcattcc gggctacgtc attaagcccg tttctgtgac aggtagtgtc      2040
     cactga                                                                 2046
//

If you have problems or comments...

PBIL Back to PBIL home page