(data stored in ACNUC7421 zone)

EMBL: CP001349.PE236

CP001349.PE236       Location/Qualifiers
FT   CDS_pept        complement(273321..273434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55288"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55288.1"
FT                   /translation="MGGLLPFVLLIGMSEERHLRTFGGALFSGHYLSQKRA"
     gtgggcggat tgctgccgtt cgtgctgctc atcggaatga gcgaggagcg ccatctgcgg        60
     actttcggcg gcgcgctatt cagtggacac tacctgtcac agaaacgggc ttaa             114
//

If you have problems or comments...

PBIL Back to PBIL home page