(data stored in ACNUC7421 zone)

EMBL: CP001349.PE237

CP001349.PE237       Location/Qualifiers
FT   CDS_pept        complement(273510..274676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0245"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="TIGRFAM: amidohydrolase; PFAM: peptidase M20;
FT                   peptidase dimerisation domain protein; KEGG: met:M446_3187
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55289"
FT                   /db_xref="GOA:B8I9N6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N6"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ACL55289.1"
FT                   /translation="MPVINRVAALTDEITAWRRDFHQHPELLFAVDRTAGLVAERLRAF
FT                   GCDEVVTGLGRTGVVGVIRGRRGGSGRTIGLRADMDALPIEEATEVPYRSAIPGKMHAC
FT                   GHDGHTAMLLGAAKYLAETRNFDGTAVVIFQPAEEGGGGGDAMVKDGLMERFGIQEVYG
FT                   LHNKPGLPLGHFAIRPGPIMAAVDRFTITIEGRGGHAAQPQECVDTVLISAHVITALQS
FT                   IVARNADPVASAVVSVTTMRAGEAFNVLPQTAVLNGTVRSLTEPVRRLCEERIGALAAG
FT                   IASAFGATAQTSYSRGYPVTDNHPDQAAFMADVAAEVAGEEGVDRAVDPMMGAEDFSYM
FT                   LEQRPGAYIFLGTGDGPGLHHPAYDFNDAATPYGVSLWARLIERAMPA"
     atgcccgtca tcaaccgcgt cgccgctctc acggacgaaa tcacggcctg gcggcgcgac        60
     ttccatcagc atcccgaatt gctcttcgcg gtcgaccgca ccgccggcct cgtcgccgag       120
     cgcctgcgcg ccttcggctg cgacgaggtc gtgacgggac tgggccggac cggcgtcgtc       180
     ggcgtgatcc gcggccggag aggcggatcc ggccgcacca tcggcctgcg ggccgacatg       240
     gacgcgctgc cgattgagga ggcgacggag gttccctacc gctcggccat accgggcaag       300
     atgcacgcct gcgggcatga cggccacacg gcgatgctgc tcggcgccgc caagtacctc       360
     gccgagaccc gaaacttcga cggcacggcg gtcgtgatct tccagccggc cgaggagggc       420
     ggcgggggcg gcgacgccat ggtgaaggac ggcctgatgg agcgcttcgg catccaggag       480
     gtctacgggc tccacaacaa gcccggcctg ccgctcgggc atttcgcgat ccgcccgggg       540
     cccatcatgg cggccgtcga ccgcttcacg atcaccatcg agggaagggg cggccatgcg       600
     gcccagccgc aggaatgcgt cgacacggtg ctgatctccg cccatgtcat caccgccctg       660
     caatcgatcg tggcgcgcaa tgccgacccg gtcgcctcgg cggtcgtctc cgtgaccacg       720
     atgcgggcgg gcgaggcctt caacgtgctg ccgcagacgg ccgtgctgaa cggaacggtg       780
     cgcagcctga cggagccggt gcgcaggctc tgcgaggagc gcatcggcgc gcttgccgcc       840
     ggcatcgctt cggccttcgg cgccacggcg cagaccagct acagccgcgg ctatccggtg       900
     acggacaacc atccggacca ggcggccttc atggccgacg tcgccgccga ggtggcaggc       960
     gaggagggcg tcgaccgcgc cgtcgatccg atgatggggg cggaggattt ctcctacatg      1020
     ctggagcagc ggccgggggc ctacatcttc ctcggaacgg gcgacggccc cggcctgcat      1080
     cacccggctt atgacttcaa cgacgcggcg accccctacg gcgtgtcgct gtgggcgcgg      1140
     ctgatcgagc gggcgatgcc ggcttga                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page