(data stored in ACNUC7421 zone)

EMBL: CP001349.PE238

CP001349.PE238       Location/Qualifiers
FT   CDS_pept        275040..275918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0246"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: met:M446_3188 aldose
FT                   1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55290"
FT                   /db_xref="GOA:B8I9N7"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR037481"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N7"
FT                   /inference="protein motif:PFAM:PF01263"
FT                   /protein_id="ACL55290.1"
FT                   /translation="MSETIEIRSGSTRAAIALHGAEPVSWQVEGNEYLWSGDPAHWNRH
FT                   APWLFPVVGASAGGEVFVAGRRHPMPQHGFARDSRFTVVEQAPDRVRLRLTETPETLTR
FT                   FPFRFRLDIAARVEAGRLAFACEVANTDTAPLPYALGFHPAFPWPFAGGERRAGGGYAV
FT                   RFAQAERPAAPEVGPGGLLLRTERSVPLDGDTLPLDPALFTEALVFLNAQSRSLRFTAP
FT                   SGAAIRLEAEDFPHLAVWTKPTAPFLSLECWTGHADWAEFSGDLAERDSQRLLAPGTSA
FT                   RHGVVLAFEAA"
     atgagcgaaa cgatcgagat ccgcagcggg agcacgcgcg cggccatcgc gctgcacgga        60
     gccgagccgg tctcctggca ggtggagggc aacgagtatc tctggagcgg cgatccggcg       120
     cactggaacc ggcatgcccc ctggctcttc ccggtggtcg gcgcctcggc gggcggcgag       180
     gtctttgtgg cgggccgccg ccatccgatg ccgcagcacg gctttgcgcg cgacagccgc       240
     ttcacggtgg tggagcaggc gcccgaccgg gtgcggctgc ggctcaccga gacgcccgag       300
     acgctgaccc gcttcccctt ccggttccgg ctcgacatcg cggcgcgggt ggaggcgggg       360
     cgcctcgcct tcgcctgcga ggtcgcgaat accgatacgg cgcccctccc ctacgcgctc       420
     ggctttcacc cggccttccc ctggcccttc gcgggcgggg agcggcgggc gggcggtggc       480
     tacgcggtgc gcttcgcgca ggcggagcgg cccgccgcgc cggaagtcgg gccgggtggc       540
     ctgctcctgc gcacggaacg gtccgtgcct ctcgacggcg acacgctgcc gctcgacccg       600
     gccctgttca ccgaggcgct cgtcttcctg aatgcgcaga gccgctcctt acgcttcacc       660
     gcgccctccg gcgccgcgat ccgcctggag gcggaggatt ttccgcacct tgcggtgtgg       720
     acgaagccga ccgcgccctt cctgtcgctc gaatgctgga cggggcacgc ggactgggcc       780
     gagttctccg gcgatctggc cgaacgcgat tcgcagcggc tgctcgcgcc gggaacgagc       840
     gcccggcacg gtgtggtgct ggccttcgag gcggcctga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page