(data stored in ACNUC7421 zone)

EMBL: CP001349.PE239

CP001349.PE239       Location/Qualifiers
FT   CDS_pept        276057..277025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0247"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: met:M446_3189 integrase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55291"
FT                   /db_xref="GOA:B8I9N8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I9N8"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACL55291.1"
FT                   /translation="MLQTTPPDLLLGAPDLREAAAAWLAVLKTERRFSENTVEAYGRDL
FT                   RQFLAHLARSGAAPDIPALVALKPRDLRAFMAARRAEGVSGRSLMRALAALRSFARHLD
FT                   REGHGTVSALSAVRSPKVERRLPRPLPVAAAVAMASPDIRAGEDRPDWVLARDAAVLAL
FT                   LYGAGLRIGEALGIRRKDAPVGDIDTLTILGKGQKTRMVPVIAPVQAAVADYLAVCPHP
FT                   LPPDGPLFVGQKGGPLSPRIVQLAVASLRGALGLPDSATPHALRHSFATHLLARQGDLR
FT                   AIQDLLGHASLATTQVYTKVDSARLLSAFDAAHPRAGRPGG"
     gtgctgcaga ccacgcctcc cgatctcctc ctcggcgcgc ccgacctgcg cgaggcggcg        60
     gcggcctggc tcgccgtcct gaagaccgag cggcgcttct ccgagaacac cgtcgaggcc       120
     tatgggcgcg acctgcgcca gttcctcgcc cacctcgccc gctccggcgc cgccccggac       180
     atcccggccc tcgtcgccct caagccgcgg gacctacgcg ccttcatggc ggcgcgccgc       240
     gcggaaggcg tcagcggacg cagcctgatg cgggcgctcg cggccctgcg ctccttcgcc       300
     cggcatctcg accgcgaggg ccacggcacg gtctcggccc tctccgccgt gcgctccccc       360
     aaggtggagc ggcgcctgcc ccggccgctt cccgtcgcgg cagcggtggc gatggcgagc       420
     cccgacatcc gcgcgggcga ggaccggccg gactgggtcc ttgcccggga cgccgccgtg       480
     ttggcactgc tctacggcgc cggcctgcgc atcggcgagg cgctcggcat ccggcgcaag       540
     gatgcgccgg tcggggacat cgacacgctc accatcctcg gaaaggggca gaagacccgg       600
     atggtcccgg taatcgcacc ggtccaggct gcggtggccg actacctcgc ggtctgcccc       660
     cacccgctcc cgcccgacgg cccgctcttc gtcgggcaga agggcggtcc cctgtcgccg       720
     cgcatcgtcc agctcgcggt agcctcgctg cgcggcgccc tcggcctgcc cgacagcgca       780
     acgccccacg cgctgcgcca ctccttcgcc acgcatctgc tggcgcgcca gggagacctg       840
     cgggcgatcc aggacctgct cgggcacgcc tcgctcgcca ccacgcaggt ctacacgaag       900
     gtggattctg cccggctgct cagcgccttc gacgcggcgc atccgcgggc cgggcgccct       960
     ggcggatga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page