(data stored in ACNUC7421 zone)

EMBL: CP001349.PE24

CP001349.PE24        Location/Qualifiers
FT   CDS_pept        complement(24967..25920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0025"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: met:M446_0022
FT                   uroporphyrin-III C/tetrapyrrole methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55076"
FT                   /db_xref="GOA:B8IT14"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT14"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ACL55076.1"
FT                   /translation="MSDRADDPPRRPDAPGRGPAVYTAFGLAAEAEPLAPGLHVVATPI
FT                   GNLKDVTFRALGTLAAADAVLAEDTRVTRTLLAHYGITTPLVSYHEHSGEAVRERMVAR
FT                   MKAGEALALVSDAGTPLVSDPGFKLVQAAIAAGLSVTPVPGPSAAITALMAAGLPTDRF
FT                   FFEGFLPQKAGARRNRLAALASVPGTLVLFEAPHRLPEMLADAAEMLGGGRSAAVAREL
FT                   TKLFETVRRGDLASLAAEFAASGPPKGEVVVVIGAAVEGAPGPEADADLDARLTAALAR
FT                   HSIKDAAALVADETGQKRRDVYARALALTRRADDED"
     atgagcgacc gtgccgatga tcccccccgc cgccccgacg cgcccggccg agggccggcg        60
     gtctacaccg ccttcggcct cgccgcagag gccgagcccc tggcgccggg cctgcacgtg       120
     gtggcgacgc cgatcggcaa cctcaaggac gtgaccttcc gggcgctcgg caccctcgcg       180
     gcggcggatg cggtgctggc cgaggacacc cgcgtcaccc gcacgctgct cgcccattac       240
     ggcatcacca ccccgctcgt gtcctatcac gagcattcgg gcgaggcggt ccgcgagcgc       300
     atggtggcgc gcatgaaggc cggcgaggcg ctcgccctgg tctcggatgc cggcacgccc       360
     ctggtctcgg atccgggctt caagctcgtg caggcggcga tcgccgcggg gctctccgtc       420
     acgccggtgc ccggcccctc cgcggccatc accgccctga tggccgcggg cctgccgacc       480
     gaccgcttct tcttcgaggg cttcctgccg cagaaggcgg gggcgcggcg caaccgcctc       540
     gccgccctcg cgagcgtgcc cggcaccctc gtcctgttcg aggcgcccca ccgcctgccc       600
     gagatgctgg cggatgcggc cgagatgctg gggggcgggc gctccgccgc ggtcgcccgg       660
     gaactcacca agctgttcga gaccgtgcgc cgcggcgacc tcgcctcgct cgcggccgag       720
     ttcgccgcct ccgggccgcc gaagggcgag gtggtggtgg tgatcggcgc tgccgtcgag       780
     ggcgcgccgg gccccgaggc ggatgccgac ctcgacgcgc ggctcaccgc agcgctcgcg       840
     cgccattcca tcaaggatgc ggcggcgctc gtcgccgacg agaccggcca gaagcgccgc       900
     gacgtctacg cgcgcgcgct cgcgctcacg cggcgcgccg atgacgagga ctga             954
//

If you have problems or comments...

PBIL Back to PBIL home page