(data stored in ACNUC7421 zone)

EMBL: CP001349.PE240

CP001349.PE240       Location/Qualifiers
FT   CDS_pept        complement(277345..278172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0248"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   met:M446_2362 helix-turn-helix domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55292"
FT                   /db_xref="GOA:B8I9N9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N9"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ACL55292.1"
FT                   /translation="MLGPDQRRDLGAFVRSHRERLRPDLPTGRRRTPGLRREELAARAG
FT                   ISATWCAWIEQGRDVQVSAQALDRLAAALALTRAERAYLFELAGRRDPQAARPEPVADA
FT                   PASLRDAVAALDHPAYGLDRLWNACCWNAAAARLFRGWLDGEGERNLLRFVFLDPAARR
FT                   LIPAWEERARRVIAEFRADYGHSRADPRARALVEELRRASPRFAAIWDEQDVRDRTGGL
FT                   RRFLHPEDGPVAYIQHSFAATDRPDYKLILLVPVGRDDTGARSGENRLALDEP"
     atgctcgggc cggaccagcg acgcgacctc ggggccttcg tgcgctcgca ccgcgagcgg        60
     ctgcggcccg acctgcccac gggccggcgg cggacgcccg gtctgcgccg cgaggaactc       120
     gccgcccgcg ccggcatcag cgcgacctgg tgcgcctgga tcgagcaggg acgggatgtc       180
     caggtctcgg cccaggccct cgaccgcctc gccgcggcgc tcgctctcac gcgcgccgag       240
     cgcgcctacc tgttcgagct cgccggccgg cgcgacccgc aagccgcccg gcccgagccg       300
     gtcgccgacg cccccgcctc gctgcgggac gcggtggcgg cgctcgatca tccggcctat       360
     ggcctcgacc gtctctggaa tgcctgctgc tggaatgcgg ccgccgcgcg cctgttccgc       420
     ggctggctcg acggggaggg tgagcgcaac ctcctgcgct tcgtcttcct cgaccccgcg       480
     gcgcgccgcc tgatcccggc ctgggaggag cgtgcccggc gggtgatcgc ggagttccgg       540
     gccgattacg gccacagccg cgccgatccg cgcgcccgcg cgctggtgga ggaactgcgg       600
     cgcgccagtc cacgcttcgc ggcgatctgg gacgagcagg atgtccgcga ccgcaccgga       660
     ggcctgcgcc gcttcctcca tccggaggac gggcccgtag cctatatcca gcacagcttc       720
     gcggctacgg accggccgga ctacaagctc atcctgctgg tgccggtggg ccgcgacgac       780
     accggagccc gctcgggcga gaaccggctt gcactcgatg agccctga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page