(data stored in ACNUC7421 zone)

EMBL: CP001349.PE241

CP001349.PE241       Location/Qualifiers
FT   CDS_pept        278254..279036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0249"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: met:M446_2361
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55293"
FT                   /db_xref="GOA:B8I9P0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P0"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACL55293.1"
FT                   /translation="MDRSHETPVSHETLVTAQFGPRAAAYVESAVHASGEDLAALDAIV
FT                   ARAAPRRALDLGCGGGHVAYRLARHAQAVTASDLSAEMLAAVAATAQARGLTAIETVEA
FT                   AAERLPFADASFDFIASRFSAHHWRDVEGGLREARRVAQTGAPAVFIDGCSPGSPLLDT
FT                   HLQAVELLRDPSHVRDYSASEWTGALARCGFVIEACLTWRVRMEFSSWIARMQTPETHV
FT                   RAIRALQTLASEPVRAHFAIEPDGSFLLDVLMVEARAA"
     atggacagat cgcacgagac cccggtctcg cacgagaccc tcgtcaccgc gcagttcggc        60
     ccgcgggccg cggcctatgt ggaaagcgcg gtccacgcgt cgggggagga tctcgccgcc       120
     ctcgacgcca tcgtcgcgcg ggccgccccc cggcgtgccc tcgatctcgg ctgcggcggc       180
     gggcacgttg cctatcggct ggctcggcac gcgcaggccg tgacggccag cgacctctcg       240
     gccgagatgc tggccgcggt ggccgcgacc gcgcaggcca ggggcctcac cgccatcgag       300
     accgtggagg ccgcggccga gcgcctgccc ttcgcggatg cgagcttcga tttcatcgcc       360
     agccgcttct ccgcccatca ctggcgcgac gtcgagggcg gcctgcgcga ggcgcgtcgc       420
     gtcgcccaga caggggctcc ggccgtcttc atcgacggct gctcgccggg atcccccctc       480
     ctcgacaccc atctgcaggc cgtggaactg ctgcgcgacc cctcgcacgt ccgcgactac       540
     tcggcctcgg agtggaccgg agcgctcgcc cggtgcggct tcgtcatcga ggcctgcctc       600
     acctggcgcg tgaggatgga gttctcctcc tggatcgccc gcatgcagac gcccgagacg       660
     catgtgcggg cgatccgggc acttcagacc ctggcctccg agccggtgcg ggcgcatttc       720
     gccatcgagc cggacgggtc cttcctgctc gacgtgctga tggtcgaggc gcgcgccgcc       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page