(data stored in ACNUC7421 zone)

EMBL: CP001349.PE242

CP001349.PE242       Location/Qualifiers
FT   CDS_pept        complement(279197..280309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0250"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="PFAM: GTP cyclohydrolase II; KEGG: met:M446_2360 GTP
FT                   cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55294"
FT                   /db_xref="GOA:B8I9P1"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P1"
FT                   /inference="protein motif:PFAM:PF00925"
FT                   /protein_id="ACL55294.1"
FT                   /translation="MSLTVTNVDERLRREQVQVERAIAEMRAGRAVAILGEEPALAVSA
FT                   ESVDARLAADWERLGTAVRLVLPAPRLRRIGLANRFEAGAVALPVVDPARITALALKVD
FT                   GRIDAPVACARRVDAVALELARLAQVIPAMVVAPVSGVPEDALTVDPAAVELFRTRQAA
FT                   ALRIVSRAPVPLDGAPETEFVVFRGGEGLRDQVAVVVGRPNLAEPVAVRVHSACLTGDL
FT                   FGSLKCDCGDQLRGTARWMAGNGGGIILYLDQEGRGNGLANKIRAYDLQAKGFDTYAAD
FT                   AALGFGLDQRRFDFAAAMLRCLGVGAVRVLSNNPEKIAALAEAGLTVVGAQRAPGRVTP
FT                   ENARYLAAKRDIAGHVLELGGFSCAEVSGG"
     atgtctctga cggtcacgaa cgtagacgag cggttgcgcc gcgaacaggt gcaggtcgaa        60
     cgcgccatcg ccgagatgcg cgccgggcgg gccgtcgcga tcctgggcga ggagccggcc       120
     ctggccgtat cggccgaaag cgtcgatgcg cgccttgcgg ccgattggga gcgcctcggc       180
     acggcggtgc gcctcgtgtt gccggcgccc cgcctgcgcc gcatcgggct cgccaaccgg       240
     ttcgaggccg gcgcagtggc cctgccggtc gtcgatccgg cgcggatcac cgcgctcgcc       300
     ctcaaggtcg acgggcgcat cgacgcgccg gtcgcctgtg ccaggcgggt ggatgcggtc       360
     gctctcgaac tcgcgcggct ggcgcaggtg atcccggcca tggtggtcgc gccggtctcg       420
     ggcgttccgg aggacgccct cacggtcgac cccgccgcgg tcgagctctt ccgcacgcgg       480
     caggcggctg cgctccgcat cgtcagccgg gcgccggtgc ccctcgacgg cgcgcccgag       540
     accgagttcg tggtcttccg cggcggcgag ggcttgcgcg accaggtggc ggtggtggtc       600
     gggcgtccga acctcgccga acccgtggcc gtgcgggtcc attccgcctg cctcaccggc       660
     gacctgttcg gctcgctcaa gtgcgattgc ggcgatcagc tgcgcgggac ggcccgctgg       720
     atggccggga atggcggagg catcatcctc tatctcgacc aggagggacg gggcaacggg       780
     ctcgccaaca agatccgggc ctacgacctg caggcgaagg gcttcgacac ctacgcggcc       840
     gacgcggctc tcggattcgg gctggaccag cgccgcttcg acttcgccgc cgcgatgctg       900
     cgctgcctcg gcgtcggcgc cgtgcgggtg ctcagcaaca accccgagaa gatcgccgcc       960
     ctggcggagg cgggcctgac cgtggtcggc gcccagcggg cgcccggccg ggtgacgccg      1020
     gagaacgcgc gctatctcgc cgccaagcgc gacatcgccg gccatgtcct cgaactcggc      1080
     ggcttctcct gcgcggaggt gtcgggaggc tga                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page