(data stored in ACNUC7421 zone)

EMBL: CP001349.PE243

CP001349.PE243       Location/Qualifiers
FT   CDS_pept        280361..281128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0251"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: met:M446_2359 deaminase-reductase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55295"
FT                   /db_xref="GOA:B8I9P2"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P2"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ACL55295.1"
FT                   /translation="MKAGVDYATEGWTPAQPWPGHSADVATDGNSATLFAPLADGSCDQ
FT                   PFVIAQLGQSLDGRIATLSGDSKYINRGAALDHLHRLRAHVDAIVVGIGTVLADDPRLT
FT                   VRRVAGRSPARIVIDPAGRIPAQAQCLREDGVRRIVVCRPDTRIPACAEALRIEAPEAF
FT                   PPQALVSALGRLGFRRILIEGGARTISGFIDAGAIDRLHLMVAPLLLGSGRHGLDLRPI
FT                   AALHEAMRPLTRCYPLCDGDVLFDCDLRRCAEP"
     atgaaggccg gggtggatta cgcgacagag ggatggacac ccgcgcagcc ctggccaggg        60
     cacagcgcgg acgttgcgac agatgggaac tccgccacgc ttttcgcgcc cctggcggac       120
     ggttcctgcg atcaaccttt cgtgattgcc cagcttggtc aatccctgga cgggcgaatc       180
     gccaccctgt cgggtgattc gaaatacatc aaccgcgggg ccgcgctcga tcatctccac       240
     cggctgcgcg cgcatgtcga tgccatcgtc gtcggcatcg gcacggtgct cgccgacgat       300
     ccccggctca cggtgcgccg ggtggccgga cgcagcccgg cccgaatcgt catcgacccg       360
     gccgggcgga tcccggcgca ggcccaatgc ctgcgggagg acggcgtgcg gcggatcgtc       420
     gtctgccggc cggacacccg gattcccgct tgcgccgagg ctctgcggat cgaggcgccg       480
     gaggcttttc cgccgcaggc cctggtgtcg gcgctcggcc gcctcggctt ccgccggatc       540
     ctgatcgagg gcggggcgcg gacgatctcg ggcttcatcg atgccggggc gatcgaccgg       600
     ctgcacctga tggtggcccc gctcctgctc ggctcgggcc gccacggcct cgacctgcgc       660
     cccatcgcgg ccttgcacga ggcgatgcgc ccgctcaccc gctgctaccc gctctgcgac       720
     ggcgacgtcc tgttcgattg cgacctgcgc cgctgcgccg agccgtga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page