(data stored in ACNUC7421 zone)

EMBL: CP001349.PE244

CP001349.PE244       Location/Qualifiers
FT   CDS_pept        281148..281690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0252"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: met:M446_2358
FT                   cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55296"
FT                   /db_xref="GOA:B8I9P3"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P3"
FT                   /inference="protein motif:PFAM:PF01292"
FT                   /protein_id="ACL55296.1"
FT                   /translation="MTPTRYSSVQKFLHWTIALLIFGLVPVAITMTNIGEGELQNRLFE
FT                   LHKSTGLTVLALALARILVRAARGAPALVAGLPAWQRKAARASHYALYGLIVLVPVLGW
FT                   AGTSACCAPVKWFGLFSLTLPISGGMPVGEAILKVHMAVASLLVLLVFIHIGAALHHHV
FT                   IRRDATLRRMLPGRSEV"
     atgacgccga cccgctactc gtccgtccag aaattcctgc actggaccat cgccctcctg        60
     atcttcggcc tcgttccggt ggcgatcacg atgacgaata tcggcgaggg cgagttgcag       120
     aaccggctgt tcgagctgca caagtcgact gggctgacgg tgctggcgct cgcgctcgcc       180
     cgcatcctgg tgcgggcggc ccggggcgcg ccggccctcg tcgcgggcct gcccgcatgg       240
     cagcggaagg cggcgcgtgc ctcgcactac gccctctacg ggctgatcgt gctggtgccg       300
     gtgctcggct gggcggggac ctcggcctgc tgcgcgcccg tgaaatggtt cgggctgttt       360
     tcgctgaccc tgccgatctc gggcggcatg ccggtcggcg aggccatcct gaaggttcac       420
     atggcggtgg cgtccctgct ggtgcttctg gtgttcattc atatcggcgc cgcattgcac       480
     caccacgtca tccgccgcga cgccacgctg cggcgcatgc tgccggggcg cagcgaggtg       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page