(data stored in ACNUC7421 zone)

EMBL: CP001349.PE246

CP001349.PE246       Location/Qualifiers
FT   CDS_pept        complement(282394..283293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0254"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase subunit FdhD;
FT                   KEGG: met:M446_2355 formate dehydrogenase family accessory
FT                   protein FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55298"
FT                   /db_xref="GOA:B8I9P5"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P5"
FT                   /inference="protein motif:TFAM:TIGR00129"
FT                   /protein_id="ACL55298.1"
FT                   /translation="MRKTSPSPASPNGSMPPSSGGEAAADTAIRVPTQVVAYGDPQARA
FT                   DTRPLAVEMPVNVIYGSVPYAVMMTTPADLVDFAYGFSLTEGIVRGADEIRGAAVEPGE
FT                   GGLRLVVDLAPGRLREHLARKRAMSGRTGCGVCGIDDLADIPKAETRPDAGVRVTMAAV
FT                   ERALSALYDLQILNRETRAVHAAAWADLDGRILAVREDVGRHNALDKLIGALLRAGTDP
FT                   AQGFLVITSRCSFEMAEKAASFGASVLVAISAPTSLAVERAKAHGLTLAAIARSDTVTV
FT                   FTGAERLLLAPDHPEETP"
     atgaggaaga cgtctccctc acccgcatcg cccaacggct cgatgccgcc gagtagcggc        60
     ggcgaggcag cggcggacac cgcgatccgc gtcccgacgc aggtggtcgc ctatggcgat       120
     ccgcaggcgc gggcggacac ccgtccgctc gccgtcgaga tgcccgtcaa cgtgatctac       180
     ggcagcgtgc cctacgccgt catgatgacc acgcccgctg acctcgtgga cttcgcctac       240
     ggcttcagcc tgaccgaggg catcgtgcgg ggggccgacg agatccgcgg cgccgccgtc       300
     gagccggggg aggggggctt gcggctcgtc gtcgacctcg cgcccgggcg gttgcgcgag       360
     cacctcgccc gcaagcgggc gatgagcggg cgcaccggct gcggcgtctg cggcatcgac       420
     gaccttgccg acatccccaa ggccgagacc cggcccgatg ccggggtgcg ggtgacgatg       480
     gcggcggtcg agcgggcgct ttcggccctc tacgacctcc agattctcaa ccgcgagacg       540
     cgtgcggtgc atgccgccgc ctgggcggat ctcgacggcc ggattcttgc cgtgcgcgag       600
     gatgtcggcc gccacaacgc cctggacaag ctgatcggcg cgctcctgcg cgccggcacc       660
     gatccggcgc agggcttcct cgtcatcacc agccgctgct ccttcgagat ggcggagaag       720
     gcggcgagct tcggcgcctc cgtgctcgtc gcgatctcgg cgccgacctc gcttgccgtc       780
     gagcgggcga aggcgcacgg cctcaccctg gcggcgattg cccgcagcga caccgtcacg       840
     gtcttcacgg gggccgagcg cctcctcctc gcccccgacc atccggagga aaccccatga       900
//

If you have problems or comments...

PBIL Back to PBIL home page