(data stored in ACNUC7421 zone)

EMBL: CP001349.PE247

CP001349.PE247       Location/Qualifiers
FT   CDS_pept        complement(283238..286096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0255"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, alpha subunit; PFAM:
FT                   ferredoxin; 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; 4Fe-4S ferredoxin, iron-sulphur binding,
FT                   conserved site; KEGG: mrd:Mrad2831_4998 formate
FT                   dehydrogenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55299"
FT                   /db_xref="GOA:B8I9P6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P6"
FT                   /inference="protein motif:TFAM:TIGR01591"
FT                   /protein_id="ACL55299.1"
FT                   /translation="MALIKEIDYGTPIRVAEKTVTLTIDGESVTVPAGTSVMAAAMTAG
FT                   TQIPKLCATDSLEPFGSCRLCLVEIEGRRGTPASCTTPAEDGMVVHTQTDRLAKLRKGV
FT                   MELYISDHPLDCLTCAANGDCELQDMAGAVGLREVRYEEGADHFKKSSDLYLPKDESNP
FT                   YFTYDPAKCIVCNRCVRACEEVQGTFALTIAGRGFDSRVAAGPTNFFESECVSCGACVQ
FT                   ACPTATLQEKSIIAHGQPEHSAVTTCAYCGVGCAFKAEMQGTRVVRMVPYKDGKANEGH
FT                   SCVKGRFAYGYAAHKDRITKPMIRKKITDPWREVSWEEAIAYAASEFKRIQDSFGRDAV
FT                   GGITSSRCTNEEAYLVQKLVRAAFGNNNVDTCARVCHSPTGYGLKTTLGTSAGTQDFKS
FT                   VDEADVILVVGANPTDGHPVFGSRMKKRLRQGAKLIVADPRRIDLVKSPHIKADYHLPL
FT                   KPGSNVAFVNAMAHVIVTEGLVDEAYVRERCDLADFEVWARFVADERHAPEMVGPMIGV
FT                   DPADLRAAARLYATGGAAAIYYGLGVTEHSQGSTMVMGLANLAMATGNIGKPGAGVNPL
FT                   RGQNNVQGSCDMGSFPHELSGYRHVSDDATRETFESLWGATLSAEPGLRITNMLDEAVG
FT                   GGFKGLYIQGEDIAQSDPDTHHVTAGLRAMECIVIQDLFLNETAKYAHVFLPGASFLEK
FT                   DGTFTNAERRISRVRKVMPPLGGYADWEGTMLLSNALGYPMHYTHPSEIMDEIAQLTPS
FT                   FAGVSYARLDELGSIQWPCNAEAPEGTPMMHVDRFVRGLGKFMITEYVPTDERTTAKYP
FT                   LILTTGRILSQYNVGAQTRRTHNSRWHEEDVLEIHPFDAESRGIVDGDLVALESRSGDI
FT                   ALKARVTERMQPGIVYTTFHHAKTGANVITTDYSDWATNCPEYKVTAVQVRRTNRPSDW
FT                   QARFYEEDVSLTRIAQRLDAAE"
     atggccctga tcaaggaaat cgactacggc accccgatcc gcgtcgccga gaagacggtg        60
     acgctgacga tcgatggcga gagcgtgacc gtgccggccg gcacctccgt gatggccgcc       120
     gccatgacgg ccggcacgca gatccccaag ctctgcgcca ccgacagcct cgaacccttc       180
     ggctcctgcc gtctctgcct cgtcgagatc gaggggcggc gcggcacccc ggcctcctgc       240
     accaccccgg ccgaggacgg catggtggtg cacacccaga ccgacaggct cgccaagctg       300
     cgcaaggggg tgatggagct ctacatctcc gaccacccgc tcgactgcct gacctgtgcg       360
     gcgaacggcg attgcgagct gcaggacatg gcgggcgccg tgggcctgcg cgaggtgcgc       420
     tacgaggagg gggcggatca cttcaagaaa tcctcggacc tctacctgcc gaaggacgaa       480
     tcgaacccct acttcaccta cgacccggcg aagtgcatcg tctgcaaccg ctgcgtccgg       540
     gcctgcgagg aggtgcaggg caccttcgcg ctcaccatcg cgggccgcgg cttcgactcc       600
     cgcgtggccg ccggtcccac caacttcttc gaatccgagt gcgtctcctg cggcgcctgc       660
     gtgcaggcct gcccgaccgc gacgctccag gagaagtcga tcatcgcgca cggccagccc       720
     gagcactcgg cggtgacgac ctgcgcctat tgcggcgtcg gctgcgcctt caaggccgag       780
     atgcagggca cccgagtggt gcggatggtc ccctacaagg atggcaaggc caacgagggc       840
     cattcctgcg tcaagggccg cttcgcctac ggctacgccg cccacaagga ccgcatcacc       900
     aagccgatga tccggaaaaa aatcacggat ccctggcgcg aggtgtcgtg ggaggaggcc       960
     attgcctacg cggcctccga gttcaagcgc atccaggaca gctttggccg cgacgcggtc      1020
     ggcggcatca cctcctcgcg ctgcaccaac gaggaggcct acctcgtcca gaagctcgtg      1080
     cgcgccgcct tcggcaacaa caacgtcgat acctgcgcgc gcgtctgcca ctcgcccacg      1140
     ggctacggcc tcaagaccac gctcggcacc tccgccggca cccaggactt caagtcggtg      1200
     gatgaggccg acgtgatcct ggtggtcggc gccaacccga cggacggcca cccggtcttc      1260
     ggctcgcgga tgaagaagcg cctgcgccag ggcgccaagc tgatcgtggc cgatccgcgc      1320
     cggatcgacc tcgtgaagtc gccccacatc aaggccgact accacctgcc gctcaagccc      1380
     ggctccaacg tcgccttcgt gaacgcgatg gcgcatgtca tcgtcaccga ggggctggtc      1440
     gacgaggcct atgtgcgcga gcgctgcgac ctcgccgatt tcgaggtctg ggcccgcttc      1500
     gtggccgatg agcgccacgc gcccgaaatg gtcggcccga tgatcggcgt cgatccggcg      1560
     gatctgcgcg ccgccgcccg gctctacgcc acgggcggag ccgcggcgat ctattacggg      1620
     ctcggcgtca ccgagcacag ccagggctcg accatggtga tgggccttgc gaatctcgcg      1680
     atggccaccg gcaacatcgg caagcccggc gccggcgtga acccgctgcg cggccagaac      1740
     aacgtccagg gctcctgcga catgggctcg ttcccgcacg agctctcggg ctaccgacac      1800
     gtctcggacg acgccacccg cgagaccttc gagtcgctct ggggcgcgac gctctcggcc      1860
     gagccggggc ttcgcatcac caacatgctc gacgaggcgg tgggcggcgg cttcaagggg      1920
     ctgtacatcc agggcgagga catcgcccag tcggaccccg acacgcacca cgtcacggcg      1980
     ggcctcaggg cgatggaatg catcgtcatc caggacctgt tcctgaacga gaccgcgaaa      2040
     tacgcccatg tcttcctgcc gggcgcctcg ttcctggaga aggacggcac cttcaccaat      2100
     gccgagcggc gcatcagccg cgtgcgcaag gtgatgccgc cgctcggcgg ctacgccgac      2160
     tgggagggca ccatgctgct ctccaacgcg ctcggctacc cgatgcacta cacgcacccg      2220
     tcggagatca tggacgagat cgcgcagctc accccgagct tcgcgggcgt gtcctatgcc      2280
     cggctggacg agctcggctc gatccagtgg ccgtgcaacg cggaggcccc cgagggcacg      2340
     ccgatgatgc atgtcgaccg cttcgtgcgg ggcctcggca agttcatgat caccgagtac      2400
     gtgcccaccg acgagcgcac tacggccaag tatccgctga tcctcaccac cgggcgcatc      2460
     ctgtcccagt acaatgtcgg cgcgcagacc cggcgcaccc acaattcgcg ctggcatgag      2520
     gaggatgtgc tggagatcca tcccttcgat gccgagagcc gcggcatcgt ggacggggac      2580
     ctcgtcgcgc tggagagccg gtcgggcgac atcgcgctca aggcccgcgt caccgagcgg      2640
     atgcagccgg ggatcgtcta caccaccttc caccacgcca agacgggcgc caacgtcatc      2700
     accaccgact attcggactg ggcgaccaac tgccccgaat acaaggtgac ggcggtgcag      2760
     gtccggcgta ccaaccggcc ttccgattgg caggcccggt tctatgagga agacgtctcc      2820
     ctcacccgca tcgcccaacg gctcgatgcc gccgagtag                             2859
//

If you have problems or comments...

PBIL Back to PBIL home page