(data stored in ACNUC7421 zone)

EMBL: CP001349.PE248

CP001349.PE248       Location/Qualifiers
FT   CDS_pept        complement(286107..287666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0256"
FT                   /product="Respiratory-chain NADH dehydrogenase domain 51
FT                   kDa subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: Respiratory-chain NADH dehydrogenase domain 51
FT                   kDa subunit; KEGG: met:M446_2353 NADH dehydrogenase
FT                   (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55300"
FT                   /db_xref="GOA:B8I9P7"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P7"
FT                   /inference="protein motif:PFAM:PF01512"
FT                   /protein_id="ACL55300.1"
FT                   /translation="MSVTIFVPRDAVAVGLGAERVVTALTRGAASRNLDIRIVRTGSRG
FT                   MVWLEPMVEVATPEGRIAYGPVRPGDVESLLDAGLAEGGAHRLRIGRPEEHPFLARQQR
FT                   LTFHRCGVVDPVSVADYRAHGGYRGLARALEIGPADTVDAVKVSGLRGRGGAGFPTGIK
FT                   WNTVMLAEADQKYVVCNADEGDSGTFADRMLMEGDPFTLIEGMTIAGVAVGATRGYIYL
FT                   RSEYPNAYQILKTAIAAGERAGVLGRNILGSGKDFFLEVRLGAGAYICGEETSLLESLE
FT                   GKRGIVRAKPPIPALKGLFGRPTLVNNVLSFAAVPWILEHGGEAYANYGMGRSRGTLPI
FT                   QLAGNVKYGGLIETAFGITLRAVIEDFGGGSLSGRPVRAAQVGGPLGAYFPDVLFDTPM
FT                   DYEAFAARKGLVGHGGVVVFDDTVDMARQARFAFEFCAVESCGKCTPCRIGAVRGRETM
FT                   ERLLAGEAPAEPLRLIEDLCEVMTDGSLCAMGGLTPVPVMSAITHFPEDFDRSSRLPLA
FT                   AE"
     gtgagcgtca cgatcttcgt tccccgcgac gccgtcgcgg tcggcctcgg cgccgagcgc        60
     gtcgtcacgg ccctgacccg cggcgcggct tcgcgcaacc tcgacatccg catcgtccgc       120
     accggctcgc gcgggatggt ctggctggag ccgatggtgg aggtggcgac gccagagggc       180
     cgcatcgcct acggtccggt gcggccgggc gatgtcgagt cgctgctcga tgccgggctc       240
     gccgagggcg gcgcccatcg cctgcgcatc ggccggccgg aggaacatcc ctttctcgcc       300
     cgccagcagc gcctgacctt ccatcgctgc ggcgtggtcg atccggtctc ggtggcggat       360
     taccgggcgc atggcggcta tcgcggcctc gcgcgcgccc tggagatcgg ccctgccgac       420
     acggtcgatg cggtgaaggt ctccggcctg cgcggccgcg gcggggcggg cttcccgacc       480
     ggcatcaagt ggaacaccgt gatgctggcc gaggccgacc aaaaatacgt ggtctgcaac       540
     gccgacgagg gcgattccgg caccttcgcc gatcgcatgt tgatggaggg cgatcccttc       600
     acgctgatcg agggcatgac gatcgcgggc gtcgcggtcg gcgccacgcg cggctacatc       660
     tatctgcgct ccgaataccc gaacgcttat cagatcctga aaaccgccat cgcggcgggt       720
     gagcgggcgg gcgtgctcgg ccgcaacatc ttaggctcgg gcaaggactt cttcctcgaa       780
     gtccggctcg gcgcgggcgc ctatatctgc ggcgaggaga cctcgctcct cgaaagcctg       840
     gagggcaagc gcggcatcgt gcgggcgaag cccccgatcc cggcgctgaa gggcctgttc       900
     gggcgtccga ccctcgtcaa caacgtgctc tccttcgcgg cggtgccgtg gatcctggag       960
     catggcggcg aggcctacgc gaattacggc atgggccgct cgcgcgggac gctgccgatc      1020
     cagctcgccg gcaacgtgaa gtatggcggc ctgatcgaga ccgccttcgg catcaccttg      1080
     cgcgcggtga tcgaggattt cggcggcggc tcgctctcgg gccggccggt gcgcgccgcg      1140
     caggtgggcg gcccgctcgg cgcctatttc cccgatgtgc tgttcgacac gccgatggac      1200
     tacgaggcct tcgcggccag gaagggcctg gtcggccatg gcggcgtggt ggtgttcgac      1260
     gataccgtcg acatggcgcg ccaggcccgc ttcgccttcg agttctgtgc cgtcgaatcc      1320
     tgcggcaagt gcacgccctg ccggatcggc gcggtgcgcg ggcgcgagac tatggagcgg      1380
     ctcctcgcag gcgaggctcc ggccgagccc ctgcggctga tcgaggacct ctgcgaggtc      1440
     atgaccgacg gctcgctctg cgccatgggc ggcctcacgc ccgtgccggt gatgagcgcc      1500
     atcacccact tcccggaaga tttcgaccgc agctcccggc tgccgctggc ggccgagtga      1560
//

If you have problems or comments...

PBIL Back to PBIL home page