(data stored in ACNUC7421 zone)

EMBL: CP001349.PE249

CP001349.PE249       Location/Qualifiers
FT   CDS_pept        complement(287663..288136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0257"
FT                   /product="NADH dehydrogenase (ubiquinone) 24 kDa subunit"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone) 24 kDa
FT                   subunit; KEGG: met:M446_2352 NADH dehydrogenase
FT                   (ubiquinone) 24 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55301"
FT                   /db_xref="GOA:B8I9P8"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P8"
FT                   /inference="protein motif:PFAM:PF01257"
FT                   /protein_id="ACL55301.1"
FT                   /translation="MPGYEPWSGARAARIIAEHTHLEGATLPILHALQETFGYVDNEAI
FT                   PLIADALNLSKAEVHGCITFYHDFRAKPAGRHVVKLCRAEACQAVGADALHAEVLRRLE
FT                   VDWHGTTRDGAVTVEPVFCLGLCACGPAALIDGEPVARLDADGLQAALTEVAA"
     atgccgggat acgagccctg gagcggcgcg cgcgccgcca ggatcatcgc cgaacacacc        60
     catctggaag gtgccacgct gccgatcctg cacgccctgc aggagacctt cggctacgtg       120
     gacaacgagg cgatcccgct catcgccgat gccctgaacc tctcgaaggc cgaggttcat       180
     ggctgcatca ccttctatca cgatttccgg gccaagcccg ccggccggca cgtggtgaag       240
     ctctgccggg ccgaggcctg ccaggcggtc ggggccgatg cgctccacgc cgaggtgctg       300
     cgccgtctcg aagtcgactg gcacggcacc acccgcgacg gcgcagtgac ggtggagccg       360
     gtcttctgcc tcggcctctg cgcctgcggc ccggccgccc tcatcgacgg cgagcccgtc       420
     gcccggctcg atgccgacgg cctgcaggcc gccctgacgg aggttgcggc gtga             474
//

If you have problems or comments...

PBIL Back to PBIL home page