(data stored in ACNUC7421 zone)

EMBL: CP001349.PE25

CP001349.PE25        Location/Qualifiers
FT   CDS_pept        26098..27294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0026"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   met:M446_0023 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55077"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT15"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACL55077.1"
FT                   /translation="MAAMRFGRRGRLAASMVLALGLAACGGGVSPVVATRPVVEAPAPP
FT                   AGDAATIGAGSVKVALILPLTGPGAAAGTAMRNAAELAVQEFQNPDLKILVKDDRGSPE
FT                   GAREAASAAVAEGAELVIGPLFAGSVQGAAATARAAGKPVIAFSTDASVAARGVYLLSF
FT                   LPQPEVDRVVDEVTAAGRRSFAALIPETTYGHVVEAQFREAVARKGGRVVALERYPAGN
FT                   PAAAVGRLAPLITGPGAQADVLFLPDAPEGLAGTAGALTRAGFNPTRVKPIGTAIWNDP
FT                   RVFALPALQGGWFAAVDPGGYANFAQRYRTRFGTEPVRVASLAYDAVSLAAALNRQYGS
FT                   QRFAEPTLTNPSGFAGVDGTFRFRAEGTSERALAVFEIRGAAAAVVSPAPRALGPSGT"
     atggcggcga tgcgcttcgg acgacggggg cggctggcgg cgagcatggt gctcgccctc        60
     gggctcgccg cctgcggcgg cggggtgagc cctgtcgtcg cgacgcggcc cgttgtggag       120
     gcgcccgccc caccggccgg cgatgccgcg acgatcgggg ccggctccgt caaggtggcg       180
     ctgatcctgc cgctcaccgg cccgggcgcc gcggcgggga ccgccatgcg caacgccgcc       240
     gaactcgccg tgcaggagtt ccagaacccc gatctgaaga tcctggtgaa ggacgaccgc       300
     ggctcgcccg agggggcccg cgaggccgcg tcggcggcgg tggcggaggg ggccgaactc       360
     gtgatcggcc ccctcttcgc gggcagcgtc cagggcgccg ccgcgaccgc ccgggctgcg       420
     ggcaagccgg tgatcgcgtt ctcgaccgat gccagcgtgg ccgcccgcgg cgtctatctc       480
     ctgagcttcc tgccccagcc cgaggtcgac cgcgtcgtcg acgaggtgac ggccgcgggc       540
     cggcgctcct tcgcggcgct catcccggag acgacctacg gccatgtggt cgaggcccag       600
     ttccgcgagg cggtcgcccg caagggcggg cgcgtggtgg ccctcgagcg ctacccggcc       660
     ggcaatcccg cggcggcggt cgggcggctc gcgccgctga tcaccggacc gggcgcccag       720
     gccgacgtgc tcttcctgcc cgacgcgccc gaggggctcg ccggcacggc gggcgcgctc       780
     acccgggcgg gcttcaaccc gacgcgggtc aagccgatcg gcaccgcgat ctggaacgac       840
     ccgcgcgtct tcgcgttgcc ggccctccag ggcggctggt tcgcggcggt cgatccgggc       900
     ggctacgcca atttcgccca gcgctaccgc acccgcttcg gcaccgagcc ggtgcgggtg       960
     gcctccctcg cctacgacgc ggtctcgctc gccgccgcac tcaaccggca atacgggtcg      1020
     cagcgcttcg cggagccgac gctcaccaac ccgtccggct tcgcgggggt cgacggcacc      1080
     ttccggttca gggccgaggg aacgagcgag cgggcgctgg cggtgttcga gatccgcggc      1140
     gccgccgccg cggtggtgag cccggccccg cgggcgctcg ggccttcggg gacgtga         1197
//

If you have problems or comments...

PBIL Back to PBIL home page