(data stored in ACNUC7421 zone)

EMBL: CP001349.PE250

CP001349.PE250       Location/Qualifiers
FT   CDS_pept        288426..288824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0258"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating
FT                   GFA; KEGG: met:M446_2351 glutathione-dependent
FT                   formaldehyde-activating GFA"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55302"
FT                   /db_xref="GOA:B8I9P9"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P9"
FT                   /inference="protein motif:PFAM:PF04828"
FT                   /protein_id="ACL55302.1"
FT                   /translation="MLTGGCYCGRVRFAADAPAFHETVCHCASCRRAVGAASVAWLSVK
FT                   RASFRLTAGEPIRFRSSPGVTRSFCGTCGTSLTYEAEAYPDELDLTIASLDDPDAVPPK
FT                   DHTQAAERLRWTSLADGLPVHPRTRPGR"
     atgctgacgg gcggatgcta ttgcgggcgg gtgcgctttg cggccgatgc gccggccttc        60
     cacgagacgg tctgccactg cgcctcctgc cgccgggcgg tcggagccgc ctccgtggcg       120
     tggctcagcg tgaagcgggc atcgttccgg ctgactgcgg gagagcccat ccggttccgg       180
     tcgagcccgg gcgtcacccg cagcttctgc ggcacctgcg gcacgtcgct cacctacgag       240
     gccgaggcct atccggacga gctcgacctg acgatcgcaa gcctcgacga tcccgacgcg       300
     gtgccgccga aagaccacac ccaggcggcc gagcgcctgc gctggacctc cctcgccgac       360
     ggcctgccgg ttcatccccg gacccgtccc gggcggtag                              399
//

If you have problems or comments...

PBIL Back to PBIL home page