(data stored in ACNUC7421 zone)

EMBL: CP001349.PE251

CP001349.PE251       Location/Qualifiers
FT   CDS_pept        complement(288959..289867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0259"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: met:M446_2350 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55303"
FT                   /db_xref="GOA:B8I9Q0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL55303.1"
FT                   /translation="MIDRLEFILALAREQHFGRAAQACGVSQQTLSAGVKQLEERLGVM
FT                   LVQRGSRFQGFTPEGERVLEWARRIVGDARAMRQEVAALRRGLSGTLRMAAVPTATPVV
FT                   AALTTPFRARHPAVRFSVQSATSHEIIRQIANLELDAGLTYLENEPLGRVTMVPLYREQ
FT                   YRLLTAADGIYGGRDSVTWAEVAHIPLCLLTPNMQNRRIIDRQLRAVGAEPAPILESNS
FT                   MIVLVTHVRTAKWASIMPAALAETFRLTERVRAVPITDPDVSHTIGLVVPDRDPMTPLV
FT                   AAFLAEARAIAPHLENDLAAL"
     atgatcgacc gactggaatt catcctcgcg ctggcgcgag aacagcattt cgggcgcgcc        60
     gcccaggcct gcggcgtctc ccagcagacc ctctcggccg gcgtgaagca gctggaggag       120
     cggctgggcg tgatgctggt gcagcgcggc tcgcgcttcc agggcttcac gcccgagggc       180
     gagcgcgtgc tcgaatgggc ccggcgcatc gtcggcgacg cgcgcgccat gcgccaggag       240
     gtggcggccc tgcgtcgggg cctgtcgggc acgctgcgga tggcggcggt gccgaccgcg       300
     acccccgtgg tggcggccct gacgacgccg ttccgggcgc gccacccggc ggtgcgcttc       360
     agcgtgcaat cggcgacctc ccacgagatc atccgccaga tcgccaatct cgagctcgat       420
     gcgggcctga cctacctgga gaacgagccc ctcggccgcg tcaccatggt gccgctctac       480
     cgggagcagt accggctgct caccgcggcg gacggcatct atggcgggcg cgacagcgtg       540
     acctgggcgg aggtggcgca tatcccgctc tgcctgctca cgcccaacat gcagaaccgg       600
     cgcatcatcg accggcagct ccgcgctgtc ggggccgagc cggccccgat cctcgaatcg       660
     aactcgatga tcgtgctcgt cacccatgtg cgcacggcga aatgggcgag catcatgccg       720
     gcggcgctcg ccgagacctt caggctgacc gaacgcgtcc gggcggtgcc gatcaccgac       780
     ccggatgtca gccacacgat cggcctcgtg gtgccggatc gcgaccccat gacgccgctg       840
     gtcgccgcct ttctggccga ggcgcgcgcc atcgcgcccc atctcgaaaa cgatctcgcg       900
     gccctctga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page