(data stored in ACNUC7421 zone)

EMBL: CP001349.PE252

CP001349.PE252       Location/Qualifiers
FT   CDS_pept        290210..291076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0260"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /note="TIGRFAM: cytochrome c oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; cytochrome C oxidase
FT                   subunit II transmembrane region; KEGG: met:M446_2349
FT                   cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55304"
FT                   /db_xref="GOA:B8I9Q1"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q1"
FT                   /inference="protein motif:TFAM:TIGR02866"
FT                   /protein_id="ACL55304.1"
FT                   /translation="MGMARAQHRRFGRSFVGGAAIAAALLTGTAAFAAGTGQPEPWQMD
FT                   LQKPVTEVATEIYNFHHLLNVIMVGIVLLVLVLLLLVIFRFNERSQPNPSRTTHNTILE
FT                   VAWTVVPVLILVAIAIPSFRVLRTQLSDPKADLMVKVIGHAWYWSYEYPQEVGGFKFDA
FT                   NLLEGEDQEKSGQPKLLATDNEMVVPVNKIVKIQVTAADVMHSWAMPSFGFKIDAIPGR
FT                   LNQFWFKAEREGTYHGQCSELCGQRHAYMPITVRVVSDEAFQAWTAEAKTKFARIDTSG
FT                   AKFASAR"
     atggggatgg cgagggcgca gcatcggcga ttcggccgat cgttcgtggg aggcgccgcg        60
     atcgcggccg cactcctgac cgggaccgcg gccttcgcgg cgggcaccgg ccagcccgag       120
     ccgtggcaga tggacctcca gaagcccgtc acggaggtgg ccaccgagat ctacaacttc       180
     caccacctgc tcaacgtcat catggtgggc atcgtcctgc tggtgctggt gctgctgctg       240
     ctggtgatct tccgcttcaa tgagcggtcg cagccgaacc cgtcgcgcac cacgcacaac       300
     accatcctgg aggtggcctg gacggtcgtc ccggtgctga tcctggtggc gatcgcgatc       360
     ccgtccttcc gggtgctgcg cacgcagctc tccgacccga aggccgacct gatggtcaag       420
     gtcatcggcc acgcctggta ctggtcctac gagtacccgc aggaggtcgg cggcttcaag       480
     ttcgacgcca acctgctcga gggcgaagac caggagaagt caggccagcc caagctgctc       540
     gccaccgaca acgagatggt cgtgccggtg aacaagatcg tgaagatcca ggtcaccgcc       600
     gcggacgtga tgcattcctg ggcgatgccg tccttcgggt tcaagatcga cgcgatcccg       660
     ggccgcctga accagttctg gttcaaggct gagcgcgagg gtacctatca tggccagtgc       720
     tccgaactct gcggccagcg ccacgcctac atgcccatca ccgtgcgcgt ggtgagcgac       780
     gaggccttcc aggcctggac cgccgaggcg aagaccaagt tcgcccgcat cgacaccagc       840
     ggggccaagt tcgcctccgc ccgctga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page