(data stored in ACNUC7421 zone)

EMBL: CP001349.PE253

CP001349.PE253       Location/Qualifiers
FT   CDS_pept        291147..292775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0261"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="TIGRFAM: cytochrome c oxidase, subunit I; PFAM:
FT                   cytochrome c oxidase subunit I; KEGG: met:M446_2348
FT                   cytochrome c oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55305"
FT                   /db_xref="GOA:B8I9Q2"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q2"
FT                   /inference="protein motif:TFAM:TIGR02891"
FT                   /protein_id="ACL55305.1"
FT                   /translation="MATAASAGHAEAHDHTPPFFQRWFNSTNHKDIGTLYLLFAFSAGI
FT                   VGAFLSFGIRMEMEQPGLQYFSNPQTYNVFVTGHGLIMVFFMVMPALIGGFGNWFVPLM
FT                   IGAPDMAFPRMNNISFWLTVAGFLSLVCSLFVEGAPGATGPGTGWTVYPPLSTDGHPGP
FT                   AVDFGIFALHLSGAGSILGAINFITTILNMRAPGMTLHKMPLFAWSMLVTAFLLLLSLP
FT                   VLAGAITMLLTDRNFGTTFFSPSGGGDPILYQHLFWFFGHPEVYIMILPAFGIVSHIIS
FT                   TFSRKPIFGYLAMAYAMVAIGVVGFVVWAHHMYTVGLTLQTQSYFVFATMVIAVPTGVK
FT                   IFSWIATMWGGSIRFTAAMHWAVGFVFLFTVGGVTGVILANAAVDRYLHDTYYVVAHFH
FT                   YVLSLGAVFIIFAGVYYWFPKMTGRMIPEWAGKLHFWLAFIGANVLFFPMHFLGLAGMP
FT                   RRYADYPDAFAGWHYVATMGGHVFALGMVVFVIGVVLAFRSKERAADNPWGEGATTLEW
FT                   TLSSPPPFHQYETLPVIVDEPSHAH"
     atggcaaccg ccgcatcggc cgggcacgct gaggcccacg atcacacccc accgttcttc        60
     cagcgctggt tcaattccac gaaccacaag gatatcggca cgctctacct gctcttcgcc       120
     ttctcggcgg gcatcgtggg cgccttcctg tccttcggca tccgcatgga gatggagcag       180
     cccgggctgc agtacttctc caacccgcag acctacaacg tcttcgtgac cggccacggc       240
     ctcatcatgg tgttcttcat ggtgatgccg gcgctgatcg gcggcttcgg caactggttc       300
     gtgccgctga tgatcggggc gcccgatatg gcgttcccgc gcatgaacaa catctcgttc       360
     tggctcacgg tggcgggctt cctcagcctc gtctgctccc tcttcgtcga gggcgcgccg       420
     ggcgcgaccg gccccggcac cggctggacg gtctatccgc cgctctccac cgacggccat       480
     cccggcccgg cggtcgattt cggcatcttc gccctgcacc tctcgggcgc gggctcgatc       540
     ctgggcgcca tcaacttcat caccaccatc ctgaacatgc gcgcgccggg catgaccctg       600
     cacaagatgc cgctgttcgc gtggtcgatg ctggtgacgg ccttcctgct gctgctgtcg       660
     ctcccggtgc tcgccggcgc gatcaccatg ctgctcaccg accgcaactt cggcaccacc       720
     ttcttcagcc cgtccggcgg cggcgacccg atcctctacc agcacctgtt ctggttcttc       780
     ggtcaccccg aagtctacat catgatcctg ccggccttcg gcatcgtctc gcacatcatc       840
     tcgaccttct cgagaaagcc gatcttcggc tatctggcga tggcctacgc gatggtggcg       900
     atcggcgtgg tcggcttcgt ggtctgggcc caccacatgt acacggtcgg cctgacgctg       960
     cagacgcagt cctacttcgt cttcgccacg atggtcatcg cggtgcccac cggcgtgaag      1020
     atcttctcct ggatcgccac catgtggggc ggctcgatcc gcttcacggc cgccatgcat      1080
     tgggccgtcg gcttcgtctt cctgttcacg gtcggcggcg tcaccggcgt gatcctggcc      1140
     aacgcggccg tcgaccgcta cctgcacgac acgtactacg tcgtcgcaca cttccactac      1200
     gtgctgtcgc tcggcgcagt cttcatcatc ttcgcgggcg tctactactg gttcccgaag      1260
     atgaccggcc ggatgatccc ggaatgggcg ggcaagctgc acttctggct cgccttcatc      1320
     ggcgccaacg tgctgttctt cccgatgcac ttcctcggcc tcgccggcat gccgcggcgc      1380
     tacgcggatt acccggacgc cttcgcgggc tggcactacg tggcgaccat gggcgggcac      1440
     gtctttgcgc tcggcatggt ggtgttcgtg atcggcgtgg tgctggcctt ccgctcgaag      1500
     gagcgcgcgg cggacaatcc gtggggcgag ggcgccacga ccctggaatg gaccctctcc      1560
     tcgccgccgc ccttccacca gtacgagacc cttccggtga tcgtcgacga gccgtcgcac      1620
     gcgcactga                                                              1629
//

If you have problems or comments...

PBIL Back to PBIL home page