(data stored in ACNUC7421 zone)

EMBL: CP001349.PE254

CP001349.PE254       Location/Qualifiers
FT   CDS_pept        292907..293860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0262"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: met:M446_2347 protoheme IX
FT                   farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55306"
FT                   /db_xref="GOA:B8I9Q3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I9Q3"
FT                   /inference="protein motif:TFAM:TIGR01473"
FT                   /protein_id="ACL55306.1"
FT                   /translation="MTSLTNSLNPAQTLAPASNGDVADFFALLKPRVMALVVFTALVGM
FT                   TVSPSHVNPVIGAVSLLMIAVGAGASGCLNMWWDADIDAVMTRTRSRPIPAGRIRPEEA
FT                   LTFGLVLAVGSVLMLGLAANWLAAGLLAFTIVFYTVIYSMWLKRATAQNIVIGGAAGAL
FT                   PPMIGQAVVTGSVGIEGIILFLIIFIWTPPHFWALALVKSADYAKAGIPMMPNVAGPDS
FT                   TRRQIVGYTLLLAPLGLAPVALGFGGLIYGLVALLGGLAMLVLSLQVHRRREGESADKA
FT                   AMSLFGFSILYLFLLFSALLAEQGLGLMRPIPVLLG"
     atgacgagtc tgacgaacag cctgaacccc gcacagaccc tggcgcccgc ctccaacggc        60
     gacgtcgcgg atttcttcgc cctgctgaag ccgcgggtga tggcgctggt ggtcttcacg       120
     gcgcttgtcg gcatgaccgt gtcgccgagc cacgtgaacc cggtgatcgg ggccgtgtcg       180
     ctgctgatga tcgcggtcgg ggcgggcgcc tcgggctgcc tcaacatgtg gtgggatgcg       240
     gatatcgacg cggtgatgac ccgcacccgc tcgcgcccga tcccggcggg ccggatccgc       300
     ccggaggagg cgctgacctt cggcctcgtg ctcgcggtgg gctcggtgct gatgctgggc       360
     ctcgcggcga actggctggc ggcggggctg ctcgccttca cgatcgtctt ctacaccgtg       420
     atctactcga tgtggctcaa gcgtgcgacg gcgcagaaca tcgtgatcgg cggcgcggcc       480
     ggagcgcttc ccccgatgat cggccaggcc gtggtgaccg gcagcgtcgg catcgagggc       540
     atcatcctgt tcctcatcat cttcatctgg acgccgccgc atttctgggc gctcgccctc       600
     gtcaagtccg ccgactacgc caaggccggc atcccgatga tgccgaacgt ggccggcccg       660
     gattcgaccc ggcgccagat cgtcggctac acgctcctcc tcgcaccgct cggcctcgcg       720
     cccgtggcgc tcggcttcgg cggcctgatc tacggcctcg tggccctcct cggcggcctc       780
     gccatgctgg tgctgagcct gcaggtccac cgccgccgcg agggcgagag cgccgacaag       840
     gccgccatga gcctgttcgg cttctcgatc ctctatctct tcctcctgtt ctcggcgctg       900
     ctcgcggagc agggcctcgg cctgatgcgg ccgattcccg tgttgctcgg atga             954
//

If you have problems or comments...

PBIL Back to PBIL home page