(data stored in ACNUC7421 zone)

EMBL: CP001349.PE256

CP001349.PE256       Location/Qualifiers
FT   CDS_pept        294026..294637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0264"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="PFAM: cytochrome c oxidase assembly protein
FT                   CtaG/Cox11; KEGG: met:M446_2345 cytochrome c oxidase
FT                   assembly protein CtaG/Cox11"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55308"
FT                   /db_xref="GOA:B8I9Q5"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q5"
FT                   /inference="protein motif:PFAM:PF04442"
FT                   /protein_id="ACL55308.1"
FT                   /translation="MTLPRPHAGTAGRNGIRTTLLACVGVVVGMTALAYASVPLYDLFC
FT                   KATGYDGTPLVGRGPSATVSDATMTVHFDTNVSPSLPWRFQAEAPRVEAKLGETQTVFF
FT                   RVTNTASVPTTGVATFNVQPGLMGGYFVKIQCFCFNEQTLQPGETIDVPVVFYVDPAVR
FT                   TDSNTRDYTEMTLSYTYFPSRNGQPTAALATTGAGNPRPN"
     atgactctcc cccgacctca cgccggcacg gcgggccgca acggcatccg cacgacgctc        60
     ctggcctgcg tcggcgtcgt ggtcggcatg accgccctcg cctatgcgtc ggtccccctc       120
     tacgacctgt tctgcaaggc gaccggctac gacggcaccc cgctcgtcgg ccgtggcccc       180
     tcggccacgg tgtccgacgc gaccatgacg gtccatttcg acaccaacgt ctccccgagc       240
     ctgccctggc gcttccaggc ggaagcgccg cgggtcgagg ccaagctcgg cgagacccag       300
     acggtgttct tccgcgtgac caacacggcc agcgtgccga ccaccggggt cgccaccttt       360
     aacgtccagc ccgggctgat gggcggctac ttcgtcaaga tccagtgctt ctgcttcaac       420
     gagcagacgc tgcagccggg cgagacgatc gacgtgcccg tggtgttcta cgtcgatccg       480
     gcggtgcgga ctgactcgaa cacccgcgac tacacggaga tgacgctctc ctacacctat       540
     ttcccgtcgc ggaacggcca gccgacggcc gcacttgcga caacgggcgc gggcaatccg       600
     cggccgaatt ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page