(data stored in ACNUC7421 zone)

EMBL: CP001349.PE257

CP001349.PE257       Location/Qualifiers
FT   CDS_pept        294798..295664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0265"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   met:M446_2344 cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55309"
FT                   /db_xref="GOA:B8I9Q6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q6"
FT                   /inference="protein motif:PFAM:PF00510"
FT                   /protein_id="ACL55309.1"
FT                   /translation="MAEAHAKHHDYHLVNPSPWPLIGSLSALMTTSGAVFWMKSLTLAK
FT                   LAIGPYLFFAGVIGVLYTMLSWWRDVVHEANTGDHTRVVQLHHRYGMMMFIASEVMFFV
FT                   AWFWAYFDAALYAAEPIQASRLEFTGGTWPPKGVEAFDPWHLPLLNTLILLTSGTTITW
FT                   AHHALLNNDRKGLKYGLWLTIILGVLFSCVQGYEYAHAHFGFSGSIYSATFFMATGFHG
FT                   AHVIIGTIFLSVCLYRAYLGHFTPRQHLGFEFAAWYWHFVDVVWLFLFSAIYVWGSGFG
FT                   HAAAAGS"
     atggccgagg cgcacgcgaa gcaccacgac taccacctcg tcaatccgag tccctggccg        60
     ctcatcggct cgctcagtgc cctcatgacg acgtcgggcg ccgtcttctg gatgaagagc       120
     ctcaccctcg cgaagctcgc gatcggcccc tatctcttct tcgccggcgt catcggtgtg       180
     ctctacacca tgctgagctg gtggcgggac gtcgtgcacg aggccaatac cggcgaccac       240
     acccgcgtgg tgcagcttca ccaccgctac ggcatgatga tgttcatcgc ctccgaggtg       300
     atgttcttcg tcgcatggtt ctgggcctat ttcgacgcgg cgctctacgc ggccgagccg       360
     atccaggcct cgcgtctgga attcaccggc gggacctggc ccccgaaggg cgtcgaggcg       420
     ttcgatccct ggcacctgcc gctcctcaac accctgatcc tgctcacctc cggcaccacc       480
     atcacctggg cgcatcacgc cctgctgaac aacgaccgca agggcctcaa atacggcctg       540
     tggctcacca tcatcctcgg cgtgctgttc agctgcgtcc agggctacga gtatgcccac       600
     gcccatttcg gcttctcggg cagcatctac tcggccacct tcttcatggc gaccggcttc       660
     cacggcgccc acgtgatcat cggcacgatc ttcctgtcgg tctgcctcta ccgggcctat       720
     ctcggccatt tcacgccccg ccagcatctc ggcttcgagt tcgccgcctg gtactggcac       780
     ttcgtcgacg tggtctggct gttcctcttc tccgcgatct atgtctgggg ctcgggcttc       840
     ggccacgcgg cggcggccgg atcgtag                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page