(data stored in ACNUC7421 zone)

EMBL: CP001349.PE258

CP001349.PE258       Location/Qualifiers
FT   CDS_pept        295949..296317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0266"
FT                   /product="protein of unknown function DUF983"
FT                   /note="PFAM: protein of unknown function DUF983; KEGG:
FT                   met:M446_2343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55310"
FT                   /db_xref="GOA:B8I9Q7"
FT                   /db_xref="InterPro:IPR009325"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q7"
FT                   /inference="protein motif:PFAM:PF06170"
FT                   /protein_id="ACL55310.1"
FT                   /translation="MDDIRATSSPATAGLRGRCPRCGEGHLFKGFLSFRPRCEVCGLDF
FT                   KFIDSADGPAFFVMSIVGLIVVALAMWVEFAYEPPLWVHAVLWAPLAIVLSLVLVRPLK
FT                   GLMAALQFSNRAEQGRFR"
     gtggacgaca tccgcgcaac ctcatcgccg gcaacggccg gcctgcgcgg gcgctgcccg        60
     cgctgcggcg agggccatct gttcaaggga ttcctgagct tccgcccccg ctgcgaggtc       120
     tgcggcctcg acttcaagtt catcgactcg gccgacgggc cggccttctt cgtgatgtcg       180
     atcgtcgggc tcatcgtcgt ggccctcgcc atgtgggtcg agttcgccta cgagccgccg       240
     ctctgggttc acgccgtgct gtgggcaccg ctcgccatcg tgctgagcct ggtcctagtg       300
     cgtcccctca agggcctgat ggcggcccta caattctcca atagggccga gcaggggcgt       360
     ttccgctga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page