(data stored in ACNUC7421 zone)

EMBL: CP001349.PE259

CP001349.PE259       Location/Qualifiers
FT   CDS_pept        296317..297078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0267"
FT                   /product="Surfeit locus 1 family protein"
FT                   /note="PFAM: Surfeit locus 1 family protein; KEGG:
FT                   met:M446_2342 surfeit locus 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55311"
FT                   /db_xref="GOA:B8I9Q8"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q8"
FT                   /inference="protein motif:PFAM:PF02104"
FT                   /protein_id="ACL55311.1"
FT                   /translation="MDAAAEPVRRSPPWRDLLAPGLATLVCLAILLALGTWQLQRKAWK
FT                   EGVIRQVVERSRIDPPLAPPAAGTWDPAADEFKRVRITGRLLNDRETLVHGLAPGEAPG
FT                   RALQGYYVLTPLVREDGPPILINRGFVPTELRNPRDRAAGEVAGPVTVTGILRASEERG
FT                   LFVPAPDPQRGEWFNRDIPGIAAARGLTEVAPYLIEADATPNPGGWPRGGQLRVDLPNN
FT                   HLQYAFTWYGIALCLVGVFSAYAWKRLREVA"
     atggatgcgg cggcagaacc ggtccggcgc tcccctccct ggcgcgacct cctcgcgccg        60
     ggcctcgcga cgctcgtctg cctcgcgatc ctcctcgcac tcggcacttg gcaactgcag       120
     cgcaaggcct ggaaggaggg cgtgatccga caggtggtgg agcgctcgcg gatcgatccg       180
     ccgctcgcgc cccccgccgc cggaacctgg gaccccgccg ccgacgagtt caagcgggtg       240
     cgcatcaccg gccgcctcct caacgacagg gagacactgg tccacggcct cgcgccgggc       300
     gaggctccgg gccgcgccct ccagggctac tacgtgctga cgccgctcgt gcgggaggac       360
     ggcccgccga tcctgatcaa ccgcggcttc gtcccgaccg agctcaggaa cccgcgcgac       420
     cgcgcggccg gcgaggtcgc gggtccggtc acggtcaccg ggatactgcg ggcgagcgag       480
     gagcggggcc tgttcgttcc cgcgcccgat ccgcagcggg gcgaatggtt caatcgcgac       540
     attccgggca tcgccgccgc ccgtggcctc acggaggtcg cgccctacct gatcgaggcc       600
     gacgcgacgc ccaatcccgg cggctggccc cggggcggac agctccgggt cgatctgccg       660
     aacaaccacc tgcaatacgc cttcacgtgg tacggcatcg cgctgtgcct cgtcggcgtg       720
     ttctcggcct atgcctggaa gcggcttcgc gaggtggctt ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page