(data stored in ACNUC7421 zone)

EMBL: CP001349.PE26

CP001349.PE26        Location/Qualifiers
FT   CDS_pept        complement(27573..28736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0027"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.99.22"
FT                   /note="KEGG: met:M446_0024 oxygen-independent
FT                   coproporphyrinogen III oxidase; TIGRFAM: oxygen-independent
FT                   coproporphyrinogen III oxidase; PFAM: Radical SAM domain
FT                   protein; HemN domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55078"
FT                   /db_xref="GOA:B8IT16"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT16"
FT                   /inference="protein motif:TFAM:TIGR00539"
FT                   /protein_id="ACL55078.1"
FT                   /translation="MIDHPTRDVGFGVYLHWPFCAAKCPYCDFNSHVRHAPPDEAVWRA
FT                   AFAREIAHVSALTPGRTVTSIFFGGGTPSLMQPATVGALLDAVAGAWSLSPDAEITLEA
FT                   NPTSVEAERFRGYRLAGVNRVSLGVQALDDASLKRLGRLHSAAEALAAVATAARHFERY
FT                   SFDLIYARPDQTQAAWAAELREAIARAAEHLSLYQLTIEEGTPFHGLAAAGKLVTPDED
FT                   AARALFDVTQEVCAAAGLPAYEISNHARPGAESRHNLLYWRYGEYAGIGPGAHGRLVLP
FT                   EGRTGTVTERVPEAWLARVARDGHGIVTMEPLKPAEEADEFLLMGLRLAEGIDPARFAA
FT                   LAGRPIDRGRLDALVQEGLIALTGSGRIAATPKGAPVLNALVAELAA"
     atgatcgatc atcccacccg agacgtcggt ttcggggtct acctgcactg gccgttctgc        60
     gcggcgaagt gcccgtattg cgacttcaac agccacgtgc gccacgcgcc gccggacgag       120
     gcggtgtggc gggcggcctt cgcgcgcgag atcgcgcatg tctcggccct cacccccggc       180
     cgcacggtca ccagcatctt cttcgggggc ggcacgccct ccctgatgca gccggcgacc       240
     gtgggcgcgc tcctcgatgc ggtggcgggc gcctggagcc tgtcgccgga cgccgagatc       300
     accctcgaag ccaatcccac cagcgtcgag gcggagcggt tccgcggtta ccggctggcg       360
     ggggtcaacc gcgtgtcgct cggggtccag gctctcgatg acgcctcgct caagcgcctc       420
     ggccgcctgc acagcgccgc cgaggccctg gcggccgtcg cgacggcggc gcggcacttc       480
     gagcgctact ccttcgacct gatctacgcc cggcccgacc agacgcaagc ggcctgggcg       540
     gcggaactgc gggaggcgat cgcccgggcg gccgagcacc tgtcgctcta ccagctcacg       600
     atcgaggagg ggacgccgtt ccacggtctc gcggcagcgg gcaagctcgt caccccggac       660
     gaggatgcgg cccgggccct gttcgacgtg acccaggagg tctgcgcggc ggcgggcctg       720
     cccgcctatg agatctcgaa tcacgcccgg cccggggccg aatcccggca caacctgctc       780
     tattggcgct atggcgagta tgcgggcatc ggccccggcg cccatggccg cctcgtcctg       840
     ccggagggcc gcaccgggac cgtgacggag cgcgtgccgg aggcgtggct cgcccgcgtc       900
     gcccgcgatg ggcacggcat cgtgaccatg gagccgctta agcccgcgga ggaggcggac       960
     gagttcctgc tgatgggcct gcgcctggcg gaggggatcg atcccgcccg cttcgcggcc      1020
     ctggccgggc ggccgatcga ccgggggcgg ctcgacgcgc tggtgcagga agggctcata      1080
     gccctgaccg gatcgggccg gatcgccgcg acgcccaagg gggcgccggt gctgaacgca      1140
     ctggtggcgg aactcgccgc ctga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page